KEGG   Dechlorosoma suillum: Dsui_2003Help
Entry
Dsui_2003         CDS       T01657                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00010  Glycolysis / Gluconeogenesis
dsu00620  Pyruvate metabolism
dsu00640  Propanoate metabolism
dsu00680  Methane metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01120  Microbial metabolism in diverse environments
dsu01130  Biosynthesis of antibiotics
dsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsui_2003
   00620 Pyruvate metabolism
    Dsui_2003
   00640 Propanoate metabolism
    Dsui_2003
  Energy metabolism
   00680 Methane metabolism
    Dsui_2003
Enzymes [BR:dsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dsui_2003
Lipid biosynthesis proteins [BR:dsu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dsui_2003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEV26375
UniProt: G8QIG3
Position
2110023..2111999
Genome map
AA seq 658 aa AA seqDB search
MSQIESVLVENRVFPPSEEVVKRATISGMAAYEALCKEAETDYTGYWGRLAKEHVVWKQP
FTSVLDESNAPFYKWFADGKLNVSYNCLDKNVEAGLGDKVAIIFEADGGAVSKVTYKELL
SRVAKFANALKAKGIKKGDRVIIYLPMSIEGIVAMQACARIGAIHSVVFGGFSAKSLEER
ILDAGAVAVITADEQTRGGKNIPLKPAVDEALTLVGANSPVKTVIVAKRTGGACNMVAGR
DVWWTDAEAGQSDICEPEWVEAEHPLFLLYTSGSTGKPKGVQHSSGGYLLHAALTMKWTF
DIKPDDVFWCTADIGWVTGHTYITYGPLACGATEIVFEGVPTFPDAGRFWKMIQDHKVSI
FYTAPTAIRSLIKAGADLPKKYDLTSLRLLGSVGEPINPEAWMWYYNEIGGGRCPIVDTF
WQTETGGHMITPLPGVTPLVPGSCTLPFPGIQAAIVDETGHELEWGKGGFLVVKKPWPSM
IRTIWGDPERFKKSYYPEDLGGRLYLAGDGAVRNAKTGNFTITGRIDDVLNVSGHRMGTM
EIESALVANPLVAEAAVVGRPDDLTGEAICAFVVLKGSRPSGEDAKRVIKELQDWVGKEI
GPIAKPKDIRFGENLPKTRSGKIMRRLLRSLAKGEEVTQDVSTLENPAILEQLKQAGA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagatcgaatccgttctcgttgaaaaccgtgttttccccccttccgaagaagtg
gtgaagcgggcgacgatttccggcatggccgcttacgaggccctgtgcaaggaagcggaa
accgactacaccggttactggggccgtctggccaaggaacacgtggtctggaagcagcct
ttcaccagcgtgctggatgaatccaacgctcccttctacaagtggttcgccgacggcaag
ctgaacgtttcctacaactgcctggacaagaacgtcgaagccggcctgggcgacaaggtc
gccatcatcttcgaagccgacggcggtgccgtctccaaggtcacctacaaggaactgctg
tcccgcgtcgccaagttcgccaatgcgctgaaggccaagggcatcaagaagggcgaccgc
gtcatcatctacctgcccatgtccatcgagggcatcgtcgccatgcaggcctgcgcccgt
atcggcgccatccactccgtggtcttcggcggcttctccgccaagtccctggaagagcgc
atcctggatgccggcgccgtggccgtcatcaccgccgacgagcagacccgtggcggcaag
aacatccccctgaagcccgccgtcgatgaagccctgaccctggtcggcgccaactccccc
gtgaagaccgtgatcgtggccaagcgcaccggcggcgcctgcaacatggtggccggccgc
gacgtgtggtggaccgatgccgaagccggccagtccgacatctgcgaacccgagtgggtc
gaggccgagcatcccctgttcctgctctacacctccggttccaccggcaagcccaagggc
gtccagcactcttccggcggctacctgctgcacgccgccctgaccatgaagtggaccttc
gacatcaagcctgacgatgtcttctggtgcaccgccgacatcggttgggtcaccggccac
acctacatcacctacggccccctggcctgcggcgccaccgagatcgtcttcgaaggcgtg
cccaccttcccggacgccggccgcttctggaagatgatccaggaccacaaggtctccatc
ttctacaccgcgcccaccgccatccgctccctgatcaaggccggcgccgacctgccgaag
aagtacgacctgacttccctgcgcctgctgggttccgtcggcgagcccatcaaccccgaa
gcctggatgtggtactacaacgagatcggcggcggccgctgccccatcgttgataccttc
tggcagaccgaaaccggcggccacatgatcaccccgctgcccggcgtcacccccctggtg
cccggttcctgcaccctgccgttccccggcatccaggccgccatcgtcgatgagaccggc
cacgagctggagtggggcaagggcggcttcctggtggtgaaaaagccctggccctccatg
atccgcaccatctggggcgatccggagcgtttcaagaagtcctactaccctgaagacctg
ggcggccgcctgtacctggccggcgacggtgccgtgcgtaacgccaagaccggcaacttc
accatcaccggccgtatcgacgacgtcctgaacgtctccggtcaccgcatgggcaccatg
gaaatcgaatccgccctggtggccaaccccctggtggccgaggctgccgtggtgggccgt
cccgacgacctgaccggcgaagccatctgcgccttcgtggtgctgaagggctcccgtccc
tccggcgaggatgccaagcgcgtcatcaaggagctgcaggactgggtgggcaaggaaatc
ggccccatcgccaagcccaaggacatccgcttcggtgagaacctgcccaagacccgctcc
ggcaagatcatgcgtcgtctgctgcgttccctggccaagggcgaggaagtcacccaggac
gtttccaccctggagaacccggccatcctggagcaactgaaacaagccggcgcctga

DBGET integrated database retrieval system