KEGG   Dechlorosoma suillum: Dsui_2711Help
Entry
Dsui_2711         CDS       T01657                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00300  Lysine biosynthesis
dsu01100  Metabolic pathways
dsu01120  Microbial metabolism in diverse environments
dsu01230  Biosynthesis of amino acids
Module
dsu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Dsui_2711
Enzymes [BR:dsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Dsui_2711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEV27061
UniProt: G8QPG0
Position
2867837..2868988
Genome map
AA seq 383 aa AA seqDB search
MSQPISCTSDPTLDLAAQLISRRSVTPEDGGCMDLISARLKPLGFTLEAINQGNTVNLWA
RRGSAAPLVCLAGHTDVVPTGPVEQWASDPFTPTLRDGMLYGRGAADMKGSLAAFVTAVE
TFVARHPQHQGSIAFLLTSDEEGDATDGTVAVVEALQARGEGIDCCIVGEPTCVNRLGDM
VKNGRRGSLSGRLTVKGIQGHIAYPHLAKNPIHLAAPAIAELAATEWDQGNEYFPPTTWQ
VSNIRGGTGATNVIPGTVDILFNFRFSTASTPEGLKSRLEAVLAKHGIDYDLAWTLGAKP
FLTGRGPLVDAAMAAIREELNIETELSTTGGTSDGRFIAEICPQVIELGPVNATIHKIDE
CVEAAALPRLSATYCRILEKLLT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcccatttcctgcaccagcgacccgaccctggacctggctgcacagctcatt
tcccgccgctccgtcaccccggaagacggcggctgcatggacctcatcagcgcccgcctg
aagcctctgggcttcaccctggaagccatcaaccagggcaacacggtgaacctctgggcc
cgccgcggcagcgccgctcccctggtctgcctggccggccataccgacgtggtgcccacc
ggccccgtggaacaatgggcctccgatcccttcacgccgaccctgcgcgacggcatgctc
tatggccgcggtgccgccgacatgaagggttccctggccgctttcgtcaccgccgtggaa
accttcgtcgcccgccatccgcagcaccagggctccatcgccttcctgctcacctccgat
gaggaaggcgacgccaccgatggcaccgtggccgtggtggaagccctgcaggcgcgcggt
gaaggcatcgactgctgcatcgtcggcgagcccacctgcgtcaatcgcctgggcgacatg
gtgaagaacggccgccgcggctccctctccggccgcttgacggtgaagggcatccagggc
cacatcgcctacccgcacctggctaagaatccgatccatctggcagcgccggccatcgcc
gaactggcggccaccgagtgggaccagggcaacgagtacttcccgcccaccacctggcag
gtctccaacatcaggggcggcaccggcgccaccaacgtcattcccggcacggtggacatc
ctcttcaacttccgcttctccaccgccagcaccccggaaggcctgaaaagccgtctcgaa
gccgtcctcgccaagcacggcatcgactacgacctggcctggaccctgggcgccaagccc
ttcctcacggggcgtggccccctggtggatgcagccatggcagccatccgcgaagagctg
aatatcgagaccgaactttccaccaccggcggcacttccgacggccgcttcattgccgaa
atctgcccccaggtgatcgagctggggccggtgaatgccaccatccacaaaatcgacgag
tgtgtggaggcagccgccctgccccgcctctccgccacctattgccgcatcctggaaaaa
ctgctgacctga

DBGET integrated database retrieval system