KEGG   Azospira oryzae: Dsui_2735Help
Entry
Dsui_2735         CDS       T01657                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
dsu  Azospira oryzae
Pathway
dsu00260  Glycine, serine and threonine metabolism
dsu00630  Glyoxylate and dicarboxylate metabolism
dsu00670  One carbon pool by folate
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01130  Biosynthesis of antibiotics
dsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dsui_2735
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dsui_2735
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dsui_2735
Enzymes [BR:dsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Dsui_2735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AEV27082
UniProt: G8QPX5
Position
2889524..2890615
Genome map
AA seq 363 aa AA seqDB search
MTKQTVLNKAHRALNARMVDFGGWDMPVNYGSQIEEHHAVRNDCGMFDVSHMCAVDVTGA
DAKAFLLRLIANNVDKLKVPGKALYSAMLNEAGGVVDDLIVYYLTDTHYRVVINAGTADK
DLAWMDQLLGQWQLDVSVIPLREGPKAVAMIAVQGPQAKAKVWQVLPEVKAATKNLAPFF
GTQIGQFFIATTGYTGEDGFEIALPAAKAEDFWNALIAAGVRPCGLGARDTLRLEAGMNL
YGQDMDETVSPLDAGLAWTVDLKSERDFVGKSALLANGQKAQFLGLKLLDKGVLRAHQKV
VTSQGEGEITSGTFSPTLEQSIALARLPLGVAIGDTVQVDIRGKLLNAQVVKPVFARHGK
AVA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagcaaaccgtcctcaacaaggcccaccgcgccctcaatgcccgcatggtggat
ttcggcggctgggacatgccggtgaactacggctcccagatcgaggagcaccatgccgtg
cgcaacgactgcggcatgttcgacgtctctcacatgtgcgccgtggatgtcaccggtgcc
gacgccaaggccttcctcctgcgcctcatcgccaacaacgtggacaagctgaaagtcccg
ggcaaggccctctacagcgccatgctcaacgaggcaggcggcgtggtggacgatctcatc
gtctattacctcaccgacacccactaccgggtggtcatcaacgccggcaccgccgacaag
gacctggcctggatggatcagctcctgggtcagtggcagctggacgtctccgtcattccc
ctgcgcgaaggtcccaaggccgtagccatgatcgccgtgcaaggcccccaggccaaggcc
aaggtgtggcaggtgctgcccgaggtgaaggccgccacgaaaaacctggcccccttcttc
ggcacccagatcggccagttcttcattgccaccaccggctacaccggcgaggacggcttc
gagatcgccctccccgctgccaaggccgaggacttctggaatgccctgatcgccgccggc
gtgcgcccctgcggcctgggcgcccgggacaccctgcgcctggaggccggcatgaacctc
tacggccaggatatggacgaaaccgtctcccccctggacgccggcctggcctggaccgtg
gacctcaagtccgagcgggacttcgtcggcaaatccgccctcctcgccaacggccagaag
gcccagttcctcggcctcaagctgctggacaagggcgtgttgcgggcccaccagaaggtg
gtgacgagccagggcgagggtgaaatcaccagcggcaccttctcccccaccctggaacaa
tccatcgccctggcccgcctgcccctgggcgtcgccattggcgacaccgtgcaggtggat
atccgcggcaagctgctcaacgcccaggtggtcaaacccgttttcgcccgtcacggcaag
gccgtggcctga

DBGET integrated database retrieval system