KEGG   Azospira oryzae: Dsui_3127Help
Entry
Dsui_3127         CDS       T01657                                 

Definition
(GenBank) 23S RNA-specific pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
dsu  Azospira oryzae
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dsu03016]
    Dsui_3127
Enzymes [BR:dsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Dsui_3127
Transfer RNA biogenesis [BR:dsu03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    Dsui_3127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AEV27461
UniProt: G8QI58
Position
3349371..3350117
Genome map
AA seq 248 aa AA seqDB search
MLPIIYRDEHLIAIHKPPGLLVHRSLVDRHETRFAVQLLRDQIGQWVYPAHRLDRGTSGV
LLFALSSDMARELGRQFEAQTVHKTYLAVVRGHPEEVGVIDHALSRQFDDGEWQGERMNR
EPQAALTRYRRLATVELPLAVDRYPSSRYALLELEPATGRQHQLRRHLKHIAHPIIGDAT
YGKGKHNRFFAQHFACPRLLLACLRLEVRHPASDAPLLLEAPLEGDFARLVAELGWAQAL
PAGLAGQT
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgattatctaccgcgacgagcacctgatcgccatccacaagccccccggcctg
ctggtgcaccgctccctggtggaccggcacgagacccgcttcgccgtgcagctgctgcgg
gaccagatcggccagtgggtctacccggcccatcgcctggaccggggcacttccggcgtg
ctgctgttcgccctcagcagcgacatggcgcgggaactggggcgccagttcgaggcccag
acggtgcacaagacctacctggcggtggtgcgcggccatccggaggaagtcggcgtcatc
gaccatgccctcagccgccagttcgacgacggggaatggcagggggagcgcatgaaccgg
gagccccaggccgccctcacccgctaccggcgcctggccacggtggaactgccgctggcg
gtggaccgctatcccagcagccgctacgccctgcttgaactggagccggccaccggccgg
cagcaccagctgcggcgccatctcaagcacatcgcccatcccatcatcggcgacgccacc
tacggcaagggcaagcacaaccgcttcttcgcccagcacttcgcctgcccgcgcctgctg
ctggcctgcctgcgtctggaagtgagacacccggccagcgacgcccccctgctgctggaa
gcgcccctggagggcgatttcgcccggctggtggccgagctgggctgggcccaggccctg
ccggcgggactcgccggccagacctga

DBGET integrated database retrieval system