KEGG   Azospira oryzae: Dsui_3249Help
Entry
Dsui_3249         CDS       T01657                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
dsu  Azospira oryzae
Pathway
dsu00220  Arginine biosynthesis
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01130  Biosynthesis of antibiotics
dsu01230  Biosynthesis of amino acids
Module
dsu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Dsui_3249
Enzymes [BR:dsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Dsui_3249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AEV27581
UniProt: G8QJB2
Position
complement(3489831..3490754)
Genome map
AA seq 307 aa AA seqDB search
MSSIKHFLQFKDFTREEFDYLFARTRWIKDQFKNYKQYWPLTDRTLVMIFEKASTRTRLS
FEAGMQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDIVMIRTFEQEIIERFAANSR
VPVINGLTNEYHPCQIMADIFTYIEHRGPIQGKTVAWIGDSNNVCNTWLQAAEVLDFNVH
VSTPPGYEVEAERAGLYGTANFEQFSDPMEAAKGADIVTTDVWTSMGFEAENEERLKDFA
DWQVDGDMMRIAKSDAIFLHCLPAHRGEEVTAEVIDGPQSAVWDEAENRLHTQKALMEYL
LLGRVNS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaatcaagcattttctgcagttcaaggatttcacccgggaagagttcgactac
ctgttcgcgcgcacccgctggatcaaggaccagttcaagaactacaagcagtactggccc
ctgaccgatcgcaccctggtgatgattttcgagaaggccagcacccgtacccgcctctcc
ttcgaggccggcatgcagcagctgggcggttccgccatctacctcaacacccgcgattcc
cagctgggccgcggcgaaccggtggaagatgcggcccaggtcatctcccgtatgagcgac
atcgtcatgatccgcaccttcgagcaggagatcatcgagcgcttcgctgccaactcccgg
gtgccggtgatcaacggcctgaccaacgaataccacccgtgccagatcatggccgacatc
ttcacctacatcgagcaccggggccccatccagggcaagaccgtggcctggatcggcgat
tccaacaacgtctgcaacacctggctgcaggcggccgaagtgctggacttcaacgtccac
gtctccacgcccccgggctatgaggtggaggcggaacgggcgggcctctatggcaccgcc
aatttcgagcaatttagcgatcccatggaagcggccaagggggccgacatcgtcaccacc
gacgtgtggacctccatgggcttcgaagctgaaaacgaggaacgcctgaaggacttcgcc
gattggcaggtcgacggcgacatgatgcgtatcgccaagtccgacgccattttcctccat
tgcctgccggcccaccgtggcgaggaagtgaccgccgaagtgatcgacggtccccagtcc
gcagtctgggatgaggcggagaaccggctgcacacccagaaggccctgatggagtatctg
ctcctgggccgcgtcaattcttaa

DBGET integrated database retrieval system