KEGG   Azospira oryzae: Dsui_3526Help
Entry
Dsui_3526         CDS       T01657                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
dsu  Azospira oryzae
Pathway
dsu00564  Glycerophospholipid metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
Module
dsu_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dsui_3526
Enzymes [BR:dsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Dsui_3526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AEV27855
UniProt: G8QM07
Position
complement(3792779..3793423)
Genome map
AA seq 214 aa AA seqDB search
MNNYPHPIIAREGWPFLTIAVVAALAGSAFAPVYVAVPLWIIALFVLQFFRDPARKIAGG
AKTIVAPADGRIVAVEKALDPYLNREAVKVSVFMNVFNVHSNRSPVDGTVQQKWYNPGAF
VNAALDKASVENERCALWIKTADGQDVTSVQVAGLVARRILNYVDGGVQLARGQRYGFIR
FGSRVDVYLPLDARIKASIGEKVYASSTVLAELA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaactatccccatcccatcatcgcccgcgaaggctggcccttcctgaccatcgcc
gtggtggcggcccttgccggcagcgcctttgccccggtttacgtggccgtgcccctgtgg
atcatcgccctcttcgtgctgcagtttttccgcgacccggcgcgcaagatcgccggcggc
gccaagaccatcgtggcccccgccgacggccgcatcgttgccgtggaaaaggccctggac
ccctacctcaaccgtgaggcggtaaaggtcagcgtcttcatgaacgtcttcaacgtgcac
tccaaccgcagcccggtggacggcaccgtgcaacagaagtggtacaacccgggcgccttc
gtcaatgccgccctggacaaggcctctgtcgagaacgagcgctgcgccctgtggatcaag
accgccgacggccaggacgtgacctccgtgcaggtggccggcctggtggcccggcgcatc
ctcaactacgtggatggcggcgtgcagctggcccggggccagcgttacggcttcatccgc
ttcggctcccgcgtggacgtgtacctgcccctggatgcccgcatcaaggccagcatcggg
gagaaggtgtatgcttcctccaccgttcttgccgagttggcgtaa

DBGET integrated database retrieval system