KEGG   Desulfolutivibrio sulfoxidireducens: GD604_05850
Entry
GD604_05850       CDS       T06821                                 

Definition
(GenBank) molybdopterin-dependent oxidoreductase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dsx  Desulfolutivibrio sulfoxidireducens
Pathway
dsx00230  Purine metabolism
dsx01100  Metabolic pathways
dsx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GD604_05850
Enzymes [BR:dsx01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     GD604_05850
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QLA19303
Position
1337424..1339796
AA seq 790 aa
MADTTTVGRSVRQKDGRPRVTGAARYYADVSFKDLLHVRILRSPYPAAGIVGMDVKRAEA
LPGVRLVMTHRNFPRIFRTALHYVGDLVAAVVADDEEIAEEALELIAVEYVAKPFVLDLA
EAIAPGAPQAFEGEENCHDWEFHAFLSDRDPETRLFKTKTPSDYNGFGDIEKGFAEAEVI
VEQKGFRYAFCKSPAMEPRGCTAHFDGVKVQMYTHSQGLHDEKYCLAQALGIGSDKVNLV
SPFTGSSFGGKNADVLNPNMPSHYLAIAGMASLALHRPVHCGYSREEEMLCGWSRGTITD
VKIGFTKKGVLTAMDFSHWQEVGASGDKYPPKNAMLATGAVLYSRNCEHLRGKIRYVYTN
RFASVGWQGYGAPEGIFAVETTMDMAAEKLGIDPLELRRMNCMRTGDIDAGWDPLTYKSA
YISSSGIEECLDVGARHLDWKNAWRHPSQKTGRVRHGLGVAIFAMGAGRPGPGNSSEAMV
KIFPDGTAALVCAVADIGQGQHTVQCQIVAEVLGIPYAKVGLVCHDTDSTPFATLVSNSC
GTWIQGWATFEAAMDAKRQLLRLAADKLEAGPEELEVWEGGVRLIAAPGTGVTFKEAFGP
IGHYGGRHEIVGYYVNDSPHPNCLREGRKDELYIPKEKGAQFISLDVDTETGMVNNVRVI
MVQNVGRALHPKIVEGQLLTARHGVEHAVLGDECIADPRHGWLLNPNFIDYKHATIMDCV
VEPFVLEIPGDRSHPFGATACGEGAACPTLAAFSNAIYNATGVRLVETPFTPARILAGLG
KIPAKGRKNA
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggctgacaccacgacggtcggaaggtccgtgcgccaaaaggacggccggccccgggtc
acgggggcggccaggtactacgcggacgtttccttcaaggacctgctgcacgtccgtatc
ctgcgtagtccgtatcccgcggccgggattgtcggcatggacgtcaaaagggccgaggcc
ctcccgggtgttcgactggtcatgacccacaggaatttccccaggatattccgcaccgcg
ctgcactacgtgggcgacctggtcgccgccgtggtggcggacgatgaggagatcgccgag
gaggccctggagctgattgccgtggaatatgtcgcaaagcccttcgtgctggatcttgcg
gaggccatcgcgccgggcgcgccccaggccttcgagggcgaggagaactgccatgactgg
gaattccatgcgtttttaagcgaccgggatccggagacgcggctttttaagaccaagacc
ccctccgactacaacgggttcggggacattgaaaaaggctttgccgaggccgaggtcatc
gtggagcagaagggcttccgttatgccttttgcaagtcgccggccatggagccccggggc
tgcaccgcccatttcgacggggtcaaagtgcagatgtacacccattcccagggcctgcac
gacgagaagtactgcctggcccaggccctgggcatcggctcggacaaggtcaacctggtg
tcgcccttcaccgggtccagtttcggcgggaaaaacgccgacgtgctcaaccccaacatg
ccgtcccactacctggccatcgccggcatggccagcctggccctgcacaggcccgtgcac
tgcggctattcccgcgaggaggagatgctgtgcggctggtcgcgcggcaccatcaccgac
gtgaaaatcgggttcaccaaaaaaggcgttctgaccgccatggatttctcccactggcag
gaggtcggcgccagcggcgacaagtaccctccgaaaaacgccatgctggccacgggcgcg
gtgctgtattcccgcaactgcgagcacctgcgcggcaagatccgctacgtgtacaccaat
cggttcgcctcggtgggctggcagggctacggcgcgcccgagggcatcttcgcggtggag
accaccatggacatggccgcggagaaactcggcatcgaccccctggaactgcgccggatg
aactgcatgcgcaccggcgacatcgacgcgggctgggatcccctgacctacaaatccgcc
tacatctcgtcctcgggcatcgaggaatgcctggacgtgggggcaaggcatctggactgg
aaaaacgcctggcggcatcccagccaaaagaccggacgcgtccgccacggcctgggcgtg
gccatcttcgccatgggcgccggacgccccggccccggcaactccagcgaggccatggtc
aagatcttccccgacggcacggccgccctggtctgcgccgtggccgacatcggccagggg
cagcacaccgtgcaatgccagatcgtggccgaggtgctgggcatcccctacgccaaggtc
ggactggtctgtcatgacacggactccacgccgtttgccaccctggtgtccaacagttgc
gggacctggatccagggctgggccacctttgaggcggccatggacgccaaacggcaactc
ctgcgtctggcggcggacaagctggaggcagggcccgaggaactggaagtgtgggagggg
ggggtccgtctcatcgccgcgcccggcacgggcgtcaccttcaaggaggccttcggcccc
atcggacactacggcgggcggcacgagatcgtcggctactacgtcaacgactccccccat
cccaactgcctgcgggaaggccgaaaggacgagctctacatccccaaggagaagggcgcg
cagttcatctccctggacgtggacaccgagaccggcatggtcaataacgtccgggtgatc
atggtccagaacgtgggccgggcgctgcatcccaagatcgtggagggccaactcctgacc
gcccgccacggggtggagcacgcggtgctgggcgacgaatgcatcgcggacccgcgccac
ggctggctcctcaatcccaacttcatcgactacaagcacgccacgatcatggattgcgtc
gtggagccgttcgtcctcgaaatccccggggaccgatcgcatccgttcggggccaccgcc
tgcggcgagggcgccgcctgtccgaccctggccgccttctccaacgccatctacaacgcc
accggcgtccggctcgtcgagacgccgttcaccccggccagaatcctggccggtctgggc
aagatcccggccaaagggagaaaaaacgcatga

DBGET integrated database retrieval system