KEGG   Desulfitobacterium hafniense Y51: DSY0447Help
Entry
DSY0447           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dsy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DSY0447
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dsy01007]
    DSY0447
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dsy03016]
    DSY0447
Enzymes [BR:dsy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     DSY0447
Amino acid related enzymes [BR:dsy01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   DSY0447
Transfer RNA biogenesis [BR:dsy03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DSY0447
 Prokaryotic Type
    DSY0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: BAE82236
UniProt: Q250Q6
Position
514394..515827
Genome map
AA seq 477 aa AA seqDB search
MALRLFNTMSHQKEEFKPREEGKVGMYTCGPTVYNYFHVGNGRMLVVFDMIRRYLLYKGY
DVTFVQNFTDIDDKIIKRGQEEGRDPLELAQDYIGEYFKDAAALNLMPASIHPKATDHIP
EMIEIIKGLEEQGLAYAVDGDVYFAVDKLPAYGKLSGRTLEDMQAGARVEVGERKQNPMD
FALWKNAKPGEPFWESPWGKGRPGWHIECSAMSLKYLGSGFDIHGGGGDLVFPHHENEIA
QAEGYLHGETFARYWMHNAFLTINQQKMSKSLGNFFTVREILEHFPGEVIRFYLLGTHYR
SPLDFDDENLQMAQKGLERLQTSIRLADEALGRQGQNSADAASGQKLRAAAEEARREFAE
AMDDDFNSALAYASLFELGKAINAHVQAYPYSSEGLLKARATLWELADVLGFDLAKPANQ
AEAGNQKLDQVMELLLEVRAIARKKKDWEMSDLIRDRLKDLGIVLEDTPQGARWTLK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagactattcaacaccatgagccaccaaaaagaggagtttaagccacgggaa
gaaggcaaagtgggcatgtatacctgcggcccaacggtgtacaactacttccatgtgggc
aatggacggatgcttgttgtctttgatatgatccgccgctatcttttatataaaggctat
gatgtgaccttcgttcaaaactttaccgatattgatgataagattatcaagcggggccag
gaagagggaagggatcccctggagctggcccaggattatatcggagaatattttaaggat
gccgcagctcttaacctgatgccggcctccatacatcccaaagccaccgatcatattccg
gagatgatcgagattattaaaggcctggaggagcaaggcttagcttatgctgtggacggg
gacgtttattttgccgtggacaagcttcccgcttatggtaagctttccggccggacgctg
gaggatatgcaagccggtgcccgggtggaagtaggggaacgcaaacagaaccccatggat
tttgcactgtggaaaaatgccaaacccggggagcccttttgggaaagcccttggggaaaa
ggccgtcccggctggcatattgagtgtagtgccatgtccttgaagtatttgggctccggc
tttgatattcacggaggagggggagatttggtcttccctcaccatgaaaatgaaattgcc
caagcggaaggatatctccatggcgagacctttgcccggtattggatgcataatgccttt
ttaaccatcaatcaacagaaaatgtccaaatccctggggaacttttttacggttcgggag
attcttgaacatttccccggggaagtgattcgtttttatcttctgggcactcattaccgc
agtccgttggactttgatgatgagaatctgcagatggctcagaaaggtttggagcgtctg
cagaccagcatccgcctggccgatgaagcactgggccgccagggacaaaactccgcagat
gccgcctccgggcaaaagctaagggcagcagcagaagaagcccgccgggaattcgcagag
gctatggatgacgactttaactccgccctggcttatgccagcctctttgagttggggaaa
gccattaacgctcatgtgcaagcttatccctacagctcggaaggtctgttaaaagccaga
gctaccctttgggagctggctgatgtcctgggctttgatctggctaagcctgccaaccaa
gctgaagccggcaaccaaaaactggatcaagtcatggagctcctcctggaagtaagagcc
attgcccggaaaaagaaagactgggaaatgtccgacctgatccgggaccggctgaaagat
ctgggaattgttctggaagatactcctcaaggggcgcgttggaccctgaaatag

DBGET integrated database retrieval system