KEGG   Desulfitobacterium hafniense Y51: DSY0476Help
Entry
DSY0476           CDS       T00333                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dsy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DSY0476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dsy03011]
    DSY0476
Ribosome [BR:dsy03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DSY0476
  Bacteria
    DSY0476
  Archaea
    DSY0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAE82265
UniProt: Q250M7
Position
546339..546683
Genome map
AA seq 114 aa AA seqDB search
MQQAKAIARYVRISPRKVRQVVDLIRGKNVSDALAILQFTPKGATEPVTKVLQSAVANAE
HNYEMDTDALIVKEIYVDEGPTLKRIKPRAMGRADQIRKRTSHITVVVVEKKEG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagcaaaagcaattgcaagatacgtgcggatctctcctcgtaaggtgcgccaa
gtcgtcgatctcattcgcggcaagaatgtcagcgacgctctcgcgattcttcaattcacc
cctaaaggggctacagagcctgtaaccaaagttcttcaatcggcagtagccaatgcagaa
cacaactacgagatggatacagacgctttgattgttaaagaaatctacgtggatgaagga
ccgaccttgaagcgcattaaacctcgagccatgggacgtgcggatcagatccggaagcgg
accagtcacattaccgtggttgtggttgaaaagaaggagggttaa

DBGET integrated database retrieval system