KEGG   Desulfitobacterium hafniense Y51: DSY0747Help
Entry
DSY0747           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00220  Arginine biosynthesis
dsy00330  Arginine and proline metabolism
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01130  Biosynthesis of antibiotics
dsy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    DSY0747
   00330 Arginine and proline metabolism
    DSY0747
Enzymes [BR:dsy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     DSY0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAE82536
UniProt: Q24ZK6
Position
899055..899960
Genome map
AA seq 301 aa AA seqDB search
MERRKVRIIGVPIDLGADRRGVDMGPSAIRYAGLHERLKKLGWEVEDVGNIDVPIAETRE
IKDPLLKYLPEISEVNQKLYPLVAQAIKEEVIPLIIGGDHSLGIGSLAGCAASGKQFGVI
WFDTHGDYNSMETTSSGNIHGMPLAVANGIGVKELTSIGGAARKIKEENTVIIGARDFDD
EERAMIRQSGITVFTMSDIDRLGMEAVVRQGLEIANRGTHGVHISFDLDVLDPSEAPGVG
TPVQGGMTYREAHLAMEMVADCRCLLSMDVVEVNPILDAQNKTAELAVGLISSAFGQKIY
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaagaaaggtgcgcatcataggagtgcctatcgacttaggagcggatcggaga
ggggtggatatgggtcccagtgctattcgctatgcgggtcttcatgagcgcttaaaaaag
ctgggctgggaagtggaggatgtgggtaatatcgatgtaccgatcgccgagacccgggaa
attaaagatcctctgctcaaatatcttcctgagatttcagaggtcaatcaaaagctctat
cccctggtggctcaagccattaaggaggaggtcattcccttaattatcgggggggatcac
agcttgggaataggctccttagcggggtgtgccgccagcggcaagcagtttggcgttatt
tggtttgatacccatggggattataattccatggaaaccacctccagcggcaatattcat
ggcatgccgttagctgtggccaatggtattggcgttaaggagttaaccagtattggcgga
gctgcccggaagatcaaggaagaaaacaccgtaattatcggggcccgggattttgacgat
gaagagcgggctatgatccgccaatccgggattacagtgtttaccatgagcgatattgac
cgcctgggtatggaggcggtggttcggcaagggctggaaatcgccaatcgaggtacccac
ggagtccatatcagctttgatctggatgttttggaccccagtgaagctcccggtgtggga
accccggttcagggtgggatgacctatcgggaagctcatttggctatggagatggtcgcc
gattgccgatgcctgttgagcatggatgtggtagaggtcaaccccattttggatgcacag
aataagaccgcggaattagcagtggggctcataagctcagcctttggacagaagatttat
ccgtga

DBGET integrated database retrieval system