KEGG   Desulfitobacterium hafniense Y51: DSY0865
Entry
DSY0865           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00230  Purine metabolism
dsy01100  Metabolic pathways
dsy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DSY0865
Enzymes [BR:dsy01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     DSY0865
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: BAE82654
UniProt: Q24Z88
Position
1044240..1046603
AA seq 787 aa
MAKELKVVGKPLPKQGDELRATGTAMYSSDYKMPGMLHGVILRSPYASADIVDIDTSAAE
AMTGVKLVMTYKNFPSFCATSVQYVGYPVACVVALTEEIAEKAMELIKVEYKPKPFVIDP
VEALDPDSPRVFPDTPNAYPFKLNSIFTDPNEKGLFTKRELAECDGYGDLEAGFKEADII
VEDDGYSFATQHAPVPERRGALVDYDGERITMYVVTQSAQSIRNALCWSTVGITSPLKVR
ILSEFNSGTFGARGDDAGFWPDGSPDDPVAFMGGGHDKSSGFAIMAAMTLRKPVRIFYTS
NEENFFHFWGRGSANVKVRMGFKKDGTLTAWDQEELLNCGQFGNRWTLFFRNGTPMFMYS
HNLPATRIKKTALLTNIPGMVGWSGYGNPEVMFATEQVMDIAAEKLGMDPVELRKKNCAM
PGDNALNCSQAYMFTGANWFGSADYPQLLDKLAAQIGWEKRKPHTEKTGVIRSGMGMALT
CQQCAGEGVGANALVKLNVDGTAEICVTYADIGQGGRSACRQMTAEALNISFDKVRVVAG
DTDATVWGTCNACSGGTVKYGWAVYNACQDALKDLFALGAPVLGVFPEELATENGEIYVK
ADPSKRMPWAGAFFNQHNNEADPYQIIGKSTWSVPAGAKNIEKAATFCSLDVDTETGELK
NVKFYHCADVGRALNDKDTRAQLLRIHHGWESALGGTMRLDSATGKLLNGNYIDYPVATM
WECDVEPSYIESGENDPSHPYGAVGLGQALQNAVHAAAANAIYNATGVRIKQVPMTPDVI
LKALGKI
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggccaaagaactgaaagtagtaggtaagcctctacctaaacaaggcgatgagctgcgc
gcgacggggacagcaatgtatagttcggattataaaatgccgggcatgttgcacggcgta
attctgcgttcgccgtatgccagcgcggatatcgtggacatagatacttctgccgcggag
gctatgaccggggtcaagctggtcatgacctacaagaatttcccgagtttctgtgcaacg
agcgtgcaatacgtaggatacccggtagcctgcgtagtcgctttaactgaagagatcgca
gagaaagctatggagctaatcaaggtcgaatataagccgaaaccatttgtcatcgacccc
gtggaagccttggatcctgattcaccgcgggtattccccgacactccaaacgcttatccg
tttaaattgaattccatttttacagaccccaacgaaaagggtttgtttacgaagagagaa
ctggcggagtgtgatggctacggcgacttagaggccggtttcaaagaagccgatattatt
gtagaagacgatggttattcctttgcaacgcagcatgctccggtgccggaacgccgcggc
gctttggtggactatgacggcgagagaataacgatgtacgtcgttacacaatcagctcag
agtatcagaaacgccctctgttggtcgacagtcgggatcacaagcccgcttaaagttagg
attcttagtgagttcaacagcggcacattcggggcccgcggcgacgacgccggcttctgg
cctgatgggtcgccagacgaccctgtggcattcatgggcgggggccatgataaatccagt
ggctttgcgattatggcggctatgactctgcgcaagccggtcaggatattctatacttcc
aatgaggaaaacttcttccacttctggggccgcggcagcgccaacgtcaaagtaaggatg
ggctttaaaaaagatggtaccttgacggcctgggaccaggaagaattgctcaactgcggc
cagtttggtaaccgctggacgttatttttccgcaacggaacccctatgtttatgtactct
cataatcttccggctacccgaatcaaaaagactgcgctcctgaccaacatccccggtatg
gtaggctggtccggttatggcaaccctgaagtcatgtttgccaccgaacaggtcatggac
atcgctgcggagaagctgggcatggacccggtcgaactgcgtaaaaagaattgcgccatg
cccggtgataacgccttgaactgctcgcaagcatatatgttcaccggcgccaactggttt
ggttccgccgattatccgcagcttttagataagctggctgctcaaatcggctgggagaaa
cgtaaaccgcatacagaaaagaccggagttatccggagcggtatgggtatggctctcact
tgccagcagtgcgccggcgaaggcgtcggtgccaacgcgttggtcaagctgaatgtagac
ggcaccgcggagatttgcgttacttatgcagatataggtcagggcggccgctctgcttgt
cgtcaaatgacggcagaagcactgaatatctcctttgacaaagtcagagtagtcgccggt
gatacggacgctaccgtctggggcacctgtaacgcctgctccggaggtacggtaaaatat
ggttgggccgtttataatgcctgccaggacgctttgaaggatctctttgcactgggtgcc
ccagtgcttggggtttttcccgaagagctggctaccgagaatggcgagatatacgtcaag
gccgatccctccaagcgcatgccttgggccggcgccttttttaaccagcataataatgag
gcggatccctatcagatcatcgggaaaagcacttggtcggtaccggcgggagcaaaaaac
attgaaaaagcggccactttttgctcattggatgtagataccgaaaccggtgaactaaag
aatgtcaagttttatcactgcgctgacgtaggaagagccttgaacgacaaagatacccgg
gcacagctgctgcgtatccaccacgggtgggagagcgccctgggtggtacgatgagactg
gattccgccaccggtaaattgctcaatggcaattacattgattaccctgtagcgaccatg
tgggagtgcgatgtcgaacccagctacattgaatccggagagaacgatccgtcgcatcct
tatggcgcagtgggtcttggccaggcgctgcagaatgctgttcacgctgcggcggctaac
gcgatctacaatgctaccggtgtgcgtatcaagcaggttcccatgacgccggatgtcata
ctcaaagccctggggaagatatag

DBGET integrated database retrieval system