KEGG   Desulfitobacterium hafniense Y51: DSY1386Help
Entry
DSY1386           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00330  Arginine and proline metabolism
dsy00332  Carbapenem biosynthesis
dsy01100  Metabolic pathways
dsy01130  Biosynthesis of antibiotics
dsy01230  Biosynthesis of amino acids
Module
dsy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DSY1386
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    DSY1386
Enzymes [BR:dsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     DSY1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: BAE83175
UniProt: Q24XR7
Position
1626149..1627258
Genome map
AA seq 369 aa AA seqDB search
MSDLRRIVIKVGSSSLNHPEGGLDDQAIQRIAGVIAGIRQLGVECVLVSSGAVAAGVGKL
GLKTKPKDMAGKQAVAAVGQGVLIEKYALALEARGLVCAQVLLSRLDLAEASRYRNAQNT
LEQLLRYQVIPIINENDTVAVEELCFGDNDRLSALVAGLVHGDLLVILTDVDGLYSANPK
LNPQAELIEEVEDLTQVMHIAGGAGSSMGTGGMVTKLKAAEITTRFGMGMFLLHSKRMEE
IIELIQGERPLGTYFFPAAHRIMGKKRWIAYGGLSEGSIFIDEGAVKALLKGKSLLASGI
TGIDGVWERKELVRINNPDGIEVARGLVELSSEELEKVRGKHSEEMLATIPNLEGEEVVH
RDNMTLMIE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacctgcgtagaatcgtgatcaaggtagggagcagcagtttaaaccatcctgaa
ggcggtcttgatgatcaagctattcagaggattgccggggtcattgccgggatccgccag
cttggtgtagaatgtgtcctggtcagctcgggtgcagtggctgccggggtggggaagctg
ggtctaaaaaccaagcctaaggatatggccggcaaacaggcagttgccgctgtaggtcag
ggcgttttgattgagaaatacgcccttgctttggaggcacggggcttggtctgcgctcag
gtcctgctgtcccgccttgacttagctgaggcctcccgttatcgcaatgctcaaaacacc
ttagagcagctgctgcgttatcaggtgattccgattatcaatgaaaatgatactgtggcg
gtggaagagctgtgtttcggggataatgaccgcctttccgccctggtggcgggtttggtt
catggagacttgctggtgattctcacggatgtggacggactctattctgccaatcccaaa
ctcaatcctcaggcagagctcattgaggaagtggaggatttgacccaagttatgcacatc
gccggaggtgcgggcagctccatgggtacaggcgggatggtgaccaaactaaaggcagcg
gagatcaccacccgttttggtatggggatgttcctcctgcactccaagcgcatggaagaa
atcattgaactgattcaaggggagcggcctttaggcacctactttttcccggctgcccac
cgcattatgggcaagaaacgctggatcgcctatggcggcctatccgagggaagcatcttt
attgatgagggggccgtaaaggctttactcaaaggaaaaagcctgctggcttcaggcatt
accggcatcgacggtgtctgggaacgaaaagaactggtacgcatcaataacccggacgga
attgaggtggctcgcggcttagtggagctgagcagtgaagagttagagaaagtccgtggc
aagcactcggaagagatgttggccaccatccccaatctagagggtgaagaggtcgttcat
cgcgataatatgaccttgatgatcgaatga

DBGET integrated database retrieval system