KEGG   Desulfitobacterium hafniense Y51: DSY1710Help
Entry
DSY1710           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00071  Fatty acid degradation
dsy00280  Valine, leucine and isoleucine degradation
dsy00310  Lysine degradation
dsy00362  Benzoate degradation
dsy00380  Tryptophan metabolism
dsy00620  Pyruvate metabolism
dsy00630  Glyoxylate and dicarboxylate metabolism
dsy00640  Propanoate metabolism
dsy00650  Butanoate metabolism
dsy00720  Carbon fixation pathways in prokaryotes
dsy00900  Terpenoid backbone biosynthesis
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01120  Microbial metabolism in diverse environments
dsy01130  Biosynthesis of antibiotics
dsy01200  Carbon metabolism
dsy01212  Fatty acid metabolism
dsy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DSY1710
   00630 Glyoxylate and dicarboxylate metabolism
    DSY1710
   00640 Propanoate metabolism
    DSY1710
   00650 Butanoate metabolism
    DSY1710
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    DSY1710
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DSY1710
   00072 Synthesis and degradation of ketone bodies
    DSY1710
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DSY1710
   00310 Lysine degradation
    DSY1710
   00380 Tryptophan metabolism
    DSY1710
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DSY1710
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DSY1710
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSY1710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsy04147]
    DSY1710
Enzymes [BR:dsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DSY1710
Exosome [BR:dsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DSY1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAE83499
UniProt: Q24WU3
Position
complement(1985153..1986331)
Genome map
AA seq 392 aa AA seqDB search
MREVVIVSAVRTPLGSFGGALENFTGAELGAIVIKEAIKRAGILPAQVEEVIMGNVLSAA
AGQNPARQAAIKAGIPQEVPAWTLNKVCGSGLKSVICGAQAILAGDADIIVAGGMECMSS
SAYALPKARKGYRMGNDSLVDTMIMDGLTDAFHNIHMGLTAENIAEQFQISREDQDALAL
RSQNRAEAAIQSGLFDEEIVAVEIPQKRGEPLVFSQDEFPRFGTTADTLTKLRPAFKKEG
TVTAGNASGINDGAAAVVVMSKEKAEELGLAVLAKITSWASAGVDPLIMGTGPIPATRKA
LAKAGLTIADIDLVEANEAFAAQAAIVTRELGLDVEKTNVNGGAIALGHPIGASGTRVLV
TLLHELKRRDGQRGLATLCIGGGQGVSLIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtagtgattgtcagtgctgtccgtacacccctggggtcctttgggggagct
ttagagaactttacaggagccgaactgggagctatcgtgatcaaggaagcgatcaaacgg
gccggaatcctgcctgcacaagtggaagaagtcattatggggaatgtactcagtgctgcg
gcaggtcaaaaccctgcccgacaagcagcaattaaagcaggaattcctcaagaagtgccc
gcctggaccctgaataaggtctgcggttccggacttaaatcggtaatctgtggagcccag
gccatcctggccggtgatgcggatattattgtggccggcggcatggagtgcatgtcctca
tcggcttatgctctccctaaagcaagaaaaggctatcggatgggcaatgacagcctggtg
gataccatgatcatggatgggttaaccgatgctttccataatattcacatgggattgacc
gccgagaatatcgctgagcagttccagatttcccgggaggatcaggatgctttggcgctg
cgcagtcaaaaccgggccgaggccgcgatccaatccggattattcgatgaagagattgtc
gctgtggaaattccccaaaaaagaggagagcctctggtgttcagtcaggatgagtttccc
cgtttcggcaccactgccgatactttgaccaagctgcggccggcctttaagaaagagggt
acggtgactgcgggcaacgcttcagggatcaatgacggggctgccgcagtggtggtcatg
tccaaagagaaggctgaagaattgggattagcagtcctggccaaaatcacttcctgggct
tctgccggggtggatcctctgatcatggggaccggaccgatccctgcgacacgaaaagcc
ttggccaaagccggactgactattgccgatattgacctggtggaggccaatgaagccttt
gccgcccaggccgctatcgttacccgggagctgggactggatgtggaaaagaccaatgtc
aacggcggtgccatcgccttggggcaccccatcggtgcttccggcacccgcgttctggtc
acccttcttcatgaattgaaacgacgggacggacagcgggggctggccaccttatgcatc
ggcggcggtcagggcgtcagcctgattgtagagagatag

DBGET integrated database retrieval system