KEGG   Desulfitobacterium hafniense Y51: DSY2131Help
Entry
DSY2131           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy02020  Two-component system
dsy02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dsy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSY2131
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    DSY2131
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:dsy02035]
    DSY2131
Bacterial motility proteins [BR:dsy02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    DSY2131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal dCache_1 HAMP dCache_2 sCache_2
Motif
Other DBs
NCBI-ProteinID: BAE83920
UniProt: Q24VM2
Position
complement(2478715..2480727)
Genome map
AA seq 670 aa AA seqDB search
MNFGLRKKLVVSFIILISIPVVVLGFMSYTMAANALQETIEQQLSDTTKQTAEAISGDMK
AARNILNVMATNENLAEVILDQNNGELSSRVFTYLSTLQKENSDLFESLILTDAQGRGVM
DNSSINTTADYAQREYVQEALLGSVSLSDVIISMVTGNTVVAVGQPIKADNQVVGVLIGT
INFNQIVKHATKIKIGESGYAYMVDREGLLVSHPVQEKILTENLSDTASGELKQLVERMK
AGEAGEGFYSYEGVYKYTCFEPVESWVVAVTANYDEYMAAALSIRKQTIILIFSALTIAL
LIAVLIANNIVKPIKQLQSLMEKAGQGDLTVQSEINTKDEIKTLGESFNQMINSQSTIVK
HVRRGAQDLAASSEELAASSEQVSTSSQEISASIQHVAREAEEQSHAVLDASQTLVELSS
MVQLAQNRALKINQSSENTKQAAQEGRIKVNNTVEAIEMINIKSQDTMTVLQELNQLSTK
VGEIITTINAIATQTNLLALNAAIEAARAGEHGRGFAVVADEVRNLAEQSNLGSTEISTL
VTEMIKQTEKAVQSMQQEKEAVEKGVEVVRETDHTFAQIIKVVEETVGNIKEIVELTKEE
VATSDQVISLIDKVATITENTTANSQQVAAAAEEQTASTETVAASAEEISALAVSLDDLV
RQFRTKEAGK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgaattttggcttgagaaagaaattagtagtgagtttcataatactgatttctattcct
gtggttgtcttggggtttatgtcctatactatggctgccaatgccttgcaagagacgata
gaacagcagctaagcgatactaccaaacaaacagctgaagctatttcaggggatatgaaa
gcagcccggaatattttaaatgtaatggccaccaatgaaaatttggcagaagttattctt
gatcaaaacaatggggaactaagctcccgggtgttcacctatctgagtacccttcagaaa
gaaaacagtgatctgtttgaaagtctgattctgacagatgctcaaggccggggggtaatg
gataacagcagcattaatacgacggctgattatgcccagcgagagtatgtgcaagaggct
ttgcttggctcggtctcacttagtgatgtgatcatctctatggttacgggaaatactgta
gtcgcggtaggccaaccgattaaagcggataatcaagttgtcggggtgcttattggcaca
ataaatttcaatcagatcgtcaagcatgcgacaaaaataaagatcggtgaaagcggttat
gcttatatggtggatcgggagggattgctggtaagccatcctgttcaggaaaagatactg
accgaaaatctgtccgatacagccagcggagagttaaaacagctggtcgagcgcatgaaa
gcgggagaggccggggaaggattctatagctatgaaggggtatataaatatacttgtttt
gagcctgtagagagctgggtagtagctgtgacagccaattatgatgaatatatggcagcg
gccttatcgatcaggaaacaaaccattatcctcatcttcagtgctttaaccatcgcgctg
ctcattgccgtgctcatcgccaataatattgtcaagccgatcaagcaactgcaaagtctt
atggagaaggcaggacaaggagatttgaccgttcagtcggagatcaataccaaggatgaa
atcaagactctgggcgaatccttcaaccaaatgatcaatagccagtcaactattgtcaag
catgtgcgaagaggtgcccaagatcttgccgcatcctctgaagagctggcagcctcttca
gagcaggtaagcaccagtagtcaggaaatctcagccagcatccaacatgtggccagggag
gcggaggagcagagccatgcggttttggatgcttcgcaaactctagtggaattgtcaagc
atggttcagctggctcaaaaccgggctttaaaaatcaatcaaagttcggaaaataccaag
caagccgctcaggaaggccgaattaaggttaataatacagtggaagctatcgaaatgatc
aatataaaatcacaagataccatgactgtcctccaggaattaaatcaattgtccacaaaa
gtgggtgaaattattactacgatcaacgccattgcgactcaaaccaatttgttggctttg
aatgctgcgattgaagctgccagagccggtgaacatggcagggggtttgccgttgttgct
gatgaagtgcgcaatttagccgagcaatccaatcttggctccactgaaatatccaccctg
gtcacagagatgattaaacaaaccgagaaggcggtccaatcgatgcagcaggaaaaagaa
gccgtcgagaaaggggtggaagtggtcagagaaacggatcacacctttgcgcaaatcatc
aaagtagtagaggaaacggttggcaatattaaagagatcgttgagcttacgaaggaggag
gttgctacttccgatcaagtcattagtttgattgataaggtagcgacgattaccgagaat
acaactgcaaacagccaacaagttgccgcggcggcagaagaacaaaccgcttcaacagag
acggttgcggcaagtgctgaagaaatcagtgccttagcggtttctcttgatgacttggta
cggcaattccgcaccaaagaagcggggaaataa

DBGET integrated database retrieval system