KEGG   Desulfitobacterium hafniense Y51: DSY3197Help
Entry
DSY3197           CDS       T00333                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01130  Biosynthesis of antibiotics
dsy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DSY3197
Enzymes [BR:dsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DSY3197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh QRPTase_C PDZ
Motif
Other DBs
NCBI-ProteinID: BAE84986
UniProt: Q24SK6
Position
3621090..3621902
Genome map
AA seq 270 aa AA seqDB search
MDILERILVAKRKRLQARERQLPLAELKRQLEDKILSRPEKPELTPHSFHVIAEIKRASP
SKGMIPWRHSLEETLQAYESGGASFISILTEEDFFLGGPEDWHRSRMLTALPLLRKDFIL
SEYQVMESAVMGADMILLIAGILDTAALPNLLHLTHELGMKALVECRDEEDVSRALQAGA
KIIGINNRDLRTFRISLGRTQALSSLIPADCLLVSESGIHTPEDAAWVSGQGAQAVLVGE
SCLLSPDPALHIRSLREAGLGAKVVKPCPG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatatcctggaaagaattctcgtcgcgaaacgaaaaaggctccaggctcgggaaaga
cagcttccccttgccgagcttaagcggcaactggaggacaaaatccttagccgcccggag
aaaccagaacttacccctcattcctttcatgtcattgctgaaatcaagcgtgcttcccca
agcaaagggatgatcccttggcgtcactccctggaagaaacccttcaggcttatgaatcc
ggcggggcctcctttatctccatactcaccgaggaggactttttcctggggggacctgag
gactggcaccgaagccgcatgttaactgcccttccgctcctgcgcaaagattttatcctt
tccgaatatcaggtcatggaaagcgccgttatgggggcggatatgattctgctcattgcc
gggattctggacactgccgcgctccccaatctgcttcatttgactcatgaactgggaatg
aaagccctggtcgaatgccgtgatgaggaggatgtttcccgggctctccaagccggggcg
aagatcatcggtatcaataaccgggacctgcggaccttccggatcagccttggccgcacc
caagccctcagttccctaatcccggctgattgccttctggtcagcgaaagcgggatccat
acccccgaagatgcggcatgggtctccggccagggcgctcaggcagttcttgtcggcgaa
tcctgccttctgtcccctgatcctgctttgcatatccgctccctgcgcgaagcaggcctg
ggtgctaaggtggtgaaaccatgccccggataa

DBGET integrated database retrieval system