KEGG   Desulfitobacterium hafniense Y51: DSY4020Help
Entry
DSY4020           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00630  Glyoxylate and dicarboxylate metabolism
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DSY4020
Enzymes [BR:dsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     DSY4020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN F420_oxidored AdoHcyase_NAD DUF3983
Motif
Other DBs
NCBI-ProteinID: BAE85809
UniProt: Q24Q83
Position
complement(4590309..4591325)
Genome map
AA seq 338 aa AA seqDB search
MKQNVDSNRKKVFITGRIPSLAYEILSKEFDVTMHDDLRLLSKEEIIAGLKGKDALLCLL
SDAIDKDIIEANPQLKVIANYGAGYNNIDIAAAGEANIPVTNTPDVSTDATADLTFGLIL
AIARRIVEGDKETRAGRFKGWAPLYHLGVDVTGKTLGIIGMGNIGKAIARRAKGFDMKIV
YTSRTRLSEQQEKELGFTYMSLEGVLKTADFVSLSLSYSPATHHMIGERELETMKPSAYL
INTARGPLVDEKALLKALENKSIAGAALDVYEFEPQITAGLEKLDQVILTPHIGNATVET
RDAMAEIAAGNIAAVLRGEAPLTCVNQNYLKKRNMAAK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaatgtagattcaaacagaaaaaaggtgtttattacaggaaggattccttca
cttgcttatgagattctctctaaagaatttgatgtaactatgcatgatgatttgcggtta
ttgagcaaggaggaaatcattgccggtctgaaaggcaaggatgctctgctctgccttttg
tccgatgcgattgataaagatattatcgaagccaacccccagctgaaagtgatcgccaat
tatggtgccggttataacaatattgatattgctgcagctggggaagccaatatcccagta
accaacactccggatgtttccacggatgccacggcggatttgaccttcggccttattctg
gccatcgcccgccgcattgttgaaggggataaagagacccgtgccggacgctttaaaggt
tgggctcctttgtaccatctgggagtggatgttacaggcaagaccctcgggattatcggc
atggggaatattgggaaggctattgcccggcgggcgaaaggttttgatatgaaaatcgtc
tataccagccgaacacgcctctcagaacagcaggagaaagaacttgggttcacctatatg
tctttggaaggtgtgttgaaaactgcggattttgtgagcttgagcttaagctatagtcct
gccactcatcatatgatcggggaaagggagctggaaaccatgaaaccttcggcatatctg
atcaataccgctcgggggcctttggtcgatgagaaagctttgttgaaggctctggaaaat
aaaagcattgccggagcagctctggatgtgtatgagtttgaacctcagatcacggcaggg
ctggaaaagctggatcaggtcatccttactcctcatatcggcaatgctactgttgagacc
agggatgccatggccgagattgccgctggaaatattgccgctgtgctgagaggggaagct
cccttgacttgtgtcaatcaaaattatctgaagaagaggaacatggctgctaagtaa

DBGET integrated database retrieval system