KEGG   Desulfitobacterium hafniense Y51: DSY4840Help
Entry
DSY4840           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00010  Glycolysis / Gluconeogenesis
dsy00051  Fructose and mannose metabolism
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01120  Microbial metabolism in diverse environments
dsy01130  Biosynthesis of antibiotics
dsy01200  Carbon metabolism
dsy01230  Biosynthesis of amino acids
Module
dsy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dsy_M00002  Glycolysis, core module involving three-carbon compounds
dsy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY4840
   00051 Fructose and mannose metabolism
    DSY4840
   00562 Inositol phosphate metabolism
    DSY4840
Enzymes [BR:dsy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DSY4840
Exosome [BR:dsy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DSY4840
  Exosomal proteins of bladder cancer cells
   DSY4840
  Exosomal proteins of melanoma cells
   DSY4840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CO_dh
Motif
Other DBs
NCBI-ProteinID: BAE86629
UniProt: Q24MW3
Position
complement(5500046..5500831)
Genome map
AA seq 261 aa AA seqDB search
MKGAHFMAKRHPIIAGNWKMNKSLRETQEYAVKLLGVLGEVTAIDVVVCAPFTALNVLKN
ELEESVIHIGAQDMFYAPDGAYTGEISAAMLVDVACTYVILGHSERREILRETDEEIAKK
VKAALKAGLTPILCVGENLANREEGKAFAIVRGQVEKDLTDLAPDDLKRVVIAYEPIWAI
GTGKTASSEDAQEMCAMIRSTLAGIAGVVADEVNILYGGSVKADNIGELMSQPDVDGALV
GGASLEAEGFAQLVQNAVAVL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggagctcatttcatggccaaacgacatcctattatcgctggaaattggaagatg
aataaaagtctccgggagactcaggaatatgcggtaaagctcttaggagtgcttggcgaa
gtcactgcaatcgatgttgtcgtgtgtgcgccctttacagccttaaatgttctcaagaat
gagctggaggagagcgtcattcatattggggctcaggatatgttttatgcccccgatggg
gcttatacgggagagatctctgcggcgatgctggtggatgttgcctgcacctatgtcatc
ctcggacattcggagcgccgggaaattctccgtgaaacggatgaggagattgccaaaaag
gtgaaggcggcccttaaggcagggctcacccccattctctgtgtgggtgaaaacttagcc
aaccgggaagaaggcaaggcctttgcaatcgtgcgcggccaggtggaaaaggatctgacg
gatcttgccccagatgatttgaaacgggtggtcattgcctacgaacctatttgggctatc
ggcacgggtaagacagcctccagtgaagatgcccaggagatgtgcgccatgattcgctct
actttagccggaattgccggtgtggttgccgatgaggtcaatatcctctatggcggcagt
gttaaggcggacaatattggtgagctcatgagtcagccggatgtggacggcgctctggtg
ggcggggccagcctggaagccgaaggatttgcccaattggttcagaatgcggtggctgtt
ctatga

DBGET integrated database retrieval system