KEGG   Desulfurobacterium thermolithotrophum: Dester_0172Help
Entry
Dester_0172       CDS       T01427                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00020  Citrate cycle (TCA cycle)
dte00640  Propanoate metabolism
dte00660  C5-Branched dibasic acid metabolism
dte00720  Carbon fixation pathways in prokaryotes
dte01100  Metabolic pathways
dte01110  Biosynthesis of secondary metabolites
dte01120  Microbial metabolism in diverse environments
dte01130  Biosynthesis of antibiotics
dte01200  Carbon metabolism
Module
dte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dte_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dester_0172
   00640 Propanoate metabolism
    Dester_0172
   00660 C5-Branched dibasic acid metabolism
    Dester_0172
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dester_0172
Enzymes [BR:dte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dester_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp Succ_CoA_lig ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADY72829
UniProt: F0S198
Position
complement(163914..165083)
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQAKEIFKKYKLPVPNGIVVYNAQEAEEAAKELGTPVVVVKAQVHAGGRGKAGGV
KLAKSPEEAGKIASEMIGNRLRTYQNPEGLPINCVLVEAGVNIDKEFYVGLTLDREVSRP
VLMVSAAGGMEIEEIAKTNPELIIKEHIDPAIGLLPYQARKIAYKVGITDKNLLSQFVKI
AMTLSKMYFELDASLIEINPLVQTKEGEFICLDAKIDFDDNALFRHKDIQELEDTTQIDP
LELEAKKWDLNYVKLDGNIGCMVNGAGLAMATMDTIKYYGGEPANFLDVGGTATVERVAA
AFKLLLSDPNVKAIFVNIFGGIVRCDRIAGGIIEAAKQVELDRPLIVRLEGTNVELGRKM
LEESGLNIIPAKDMADGAQKAVKAAKGKL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacacgaatatcaggcaaaagaaattttcaaaaagtataaactacctgttcct
aatggaatagttgtttacaacgctcaagaagctgaagaagctgctaaagaattaggaaca
cctgtagttgttgtaaaagctcaggtccacgctggaggaagaggaaaggctggaggagtc
aaacttgcaaagtctccagaggaagctggaaaaattgcttccgaaatgataggcaaccgc
cttagaacttatcaaaatccagaaggtcttccaataaattgtgtattagttgaagccgga
gtaaatatagacaaagaattttacgtaggtcttactcttgatagagaagtttcaagacct
gttttaatggtttctgctgctggtggaatggaaattgaagaaatagcaaaaacaaatcca
gagctcattattaaagaacacattgatcctgcaattggtcttcttccatatcaggcaagg
aaaatcgcttataaggttggaattacagacaagaatcttctttcccagtttgtaaagata
gcaatgactttaagcaaaatgtactttgaacttgacgcatcattaattgaaattaacccg
cttgttcagacaaaagagggagagtttatatgtcttgatgcaaaaattgactttgacgac
aatgcactctttaggcataaagacatacaagagcttgaagatacaactcaaatcgatcct
cttgagcttgaagctaaaaagtgggatctcaactacgttaagcttgatggaaacatcggt
tgtatggttaacggtgcaggtcttgcaatggctactatggatacaatcaagtactacggc
ggagaacctgcaaacttcttagacgttggtggtactgcaacagttgaaagagtagcagca
gcatttaagctccttctttccgatccaaacgttaaggcaatttttgtaaacatcttcggt
ggaatcgtaaggtgcgataggattgcaggaggaattattgaagctgcaaagcaggttgaa
ctcgatagacctctcatcgtaagacttgaaggaacaaacgttgaacttggtagaaaaatg
cttgaagaaagtggtttaaacatcattccagcaaaagacatggctgacggtgcacaaaaa
gctgtaaaagctgccaaaggtaaactataa

DBGET integrated database retrieval system