KEGG   Desulfurobacterium thermolithotrophum: Dester_0286Help
Entry
Dester_0286       CDS       T01427                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00860  Porphyrin and chlorophyll metabolism
dte01100  Metabolic pathways
dte01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dester_0286
Enzymes [BR:dte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dester_0286
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Dester_0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 HI0933_like Pyr_redox FAD_binding_2 Thi4 MCRA NAD_Gly3P_dh_N AlaDh_PNT_C FAD_binding_3 FMO-like GIDA ApbA Dpy-30 3HCDH_N NAD_binding_9 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ADY72942
UniProt: F0S1T7
Position
complement(274426..275796)
Genome map
AA seq 456 aa AA seqDB search
MKVAVIGAGISGLSVAFYLKKGGAEVKVFEKEKTVGGKMKTIHEDGYIIETGPNGFLDGK
PYTLNLVKELGIESKLYRSSDKARKRFIYTNGRLVRLPESPIAFLASYLLSWKGKLRLVG
EFLVPPKKEDIDESLSEFAKRRIGEEALEKLLDPMVAGIFAGDPDRLSLKAAFPAIYYLE
KQYGGLIKGLIAKMKEAKKSGKKSGPAGPGGVLTSFKGGVKDLIDSLSEFLGDSIETEVE
ILGLDRIEKGWKVKYKKENEVFEETFDAIVFSTPAYITAKLLNDLNLELSKLLSEIEYSP
ISVVALGFEKKGLGHDLDGFGFLVPRSEKRKILGALWDSSVFPNRAPSGKALIRVMIGGA
RQPELALLPDEELVNIALKELRRIMKIRHYPEKIKVFKHEKGIPHYTVGHAERVEKIFRL
ISKYPGLYLCNNAYTGVGVNDCTKAAEEVARRILDG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgctgttataggagcaggaatttcaggactttctgtagctttctatttaaaa
aagggtggagcagaagtaaaagtttttgaaaaggaaaagactgttggcggtaaaatgaaa
acaatccatgaagatggttacattatagaaacaggaccaaacggttttcttgatggaaaa
ccttacactttaaaccttgtaaaagagcttggaattgagagtaagctctataggagttct
gataaagcaagaaaaaggtttatctacacaaatggaagacttgtaagacttccagaaagc
ccaattgcatttcttgcctcctatcttctttcatggaaaggaaagttaaggcttgtagga
gagtttttagttcctccaaaaaaagaggatatagatgaaagtctttctgaatttgcaaaa
agaagaattggagaagaagcacttgaaaaattgttagaccctatggttgcaggaattttt
gctggagaccctgatagactcagcctcaaagctgcctttccagccatctattaccttgaa
aaacagtacggtggtcttataaaaggccttatcgcaaaaatgaaagaagctaaaaagagt
ggaaagaaaagtggtccagcaggtcccggaggcgttcttacttcctttaaaggtggagta
aaagatttaattgattctttaagtgagtttctgggagattctattgaaacagaggtagaa
attttaggtcttgataggatagaaaaaggttggaaggtaaagtacaaaaaggaaaatgaa
gtttttgaagaaacttttgatgctattgttttttcaactcctgcctatataacagctaaa
cttttaaacgatttaaatcttgagctctctaagctcctttcagagatagagtactctccg
atttccgttgttgctcttggatttgaaaagaaaggacttggacacgaccttgatggtttt
ggctttttagttccaaggagtgaaaagagaaaaatccttggagctctctgggacagttca
gtttttccaaatagagctccaagtgggaaagctttaataagagtcatgataggtggtgca
agacaacctgaacttgcactcctgccagatgaggagcttgtaaacattgctctcaaagaa
ctcagaagaataatgaaaattcgccattatcctgagaaaataaaagtcttcaagcatgaa
aaaggtattccacactatactgttggacatgctgaaagagtagaaaagatatttagacta
attagtaaatatcctggtctttatctttgcaacaatgcctatacaggagttggagtcaac
gactgcacaaaggctgcagaagaggttgcaaggagaattcttgatggctaa

DBGET integrated database retrieval system