KEGG   Desulfurobacterium thermolithotrophum: Dester_1102Help
Entry
Dester_1102       CDS       T01427                                 

Definition
(GenBank) Phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00340  Histidine metabolism
dte01100  Metabolic pathways
dte01110  Biosynthesis of secondary metabolites
dte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dte00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Dester_1102
Enzymes [BR:dte01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Dester_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG MKRN1_C
Motif
Other DBs
NCBI-ProteinID: ADY73739
UniProt: F0S058
Position
complement(1092897..1093187)
Genome map
AA seq 96 aa AA seqDB search
MSKFCEVVNELYKIVEERKEKLPEGSYTAKLFRKGEDKILQKVGEEAVETILAFKSGDKN
HTVYETADLIYHLLVALVNKGITLDEIGEELQKRMK
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttttgtgaggtggtaaacgagctttataagatagttgaagaaagaaaagaa
aaattgccagagggttcatacacagcaaaactttttagaaaaggagaagataaaattcta
cagaaagtaggagaagaagcagtagaaactatattagcctttaagtctggtgacaaaaat
catactgtttatgaaacagcggatcttatataccacctgttagtagctcttgtaaataaa
gggataactcttgatgagataggagaagaacttcaaaagagaatgaagtag

DBGET integrated database retrieval system