KEGG   Desulfurobacterium thermolithotrophum: Dester_1462Help
Entry
Dester_1462       CDS       T01427                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dte01100  Metabolic pathways
dte01110  Biosynthesis of secondary metabolites
dte01130  Biosynthesis of antibiotics
dte01230  Biosynthesis of amino acids
Module
dte_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dester_1462
Enzymes [BR:dte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dester_1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADY74092
UniProt: F0S211
Position
1461195..1461983
Genome map
AA seq 262 aa AA seqDB search
MNILQKIVEHKKVEIEEQKKKFNLSVLREEAEKMEVPYNFKEALIKKGINIIAEVKKASP
SKGVIREDFDPVEIALSYEKGGAKAISVLTDKKFFQGSPFYLKQVAETVKLPVLRKDFII
DEFQIYGAKVLGASSFLLIVSILSDEQLKDFVLLGRELGMEPLIETHDEKEVERALKADA
EIIGVNNRDLKTFTVSIETTLKLLPLIKGEGKVLVSESGIRGKEEIIKLRKAGVNAFLVG
ETLMRKENPEEVLKSWVSLEHA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcttcaaaaaatagttgaacataaaaaggtagagattgaagagcaaaagaaa
aaatttaacctttccgttttgagagaagaagctgaaaagatggaagttccatacaacttc
aaagaagctctcatcaaaaaaggaataaacatcattgctgaagttaagaaagcttctccc
tccaaaggagttataagagaagattttgaccctgttgaaattgctctaagctacgaaaaa
ggaggagcgaaagcaatttctgttttaacagataagaaattctttcagggctcacctttt
tatctgaaacaggttgcagaaacggttaaactgccagttcttagaaaggatttcataatt
gacgagtttcaaatttacggagcaaaagttcttggagcttcttcatttctactcattgtt
tcgatactttcagatgagcaacttaaagattttgttcttttaggcagagaactaggaatg
gaacctttgattgaaactcatgatgagaaagaagtagaaagagctctaaaagcagatgcc
gaaataataggagtaaataaccgagacctaaaaactttcactgtttcaatagaaacaact
cttaaacttttacccttaataaaaggggaagggaaagtacttgtttctgaaagtggaata
agagggaaggaagaaattataaaattaaggaaagccggagttaatgcctttttagttgga
gaaactcttatgagaaaagaaaatccagaggaggttttaaaaagttgggtttccctagaa
catgcttag

DBGET integrated database retrieval system