KEGG   Dictyoglomus thermophilum: DICTH_0069Help
Entry
DICTH_0069        CDS       T00774                                 

Definition
(GenBank) alcohol dehydrogenase II
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00010  Glycolysis / Gluconeogenesis
dth00350  Tyrosine metabolism
dth00625  Chloroalkane and chloroalkene degradation
dth00626  Naphthalene degradation
dth01100  Metabolic pathways
dth01110  Biosynthesis of secondary metabolites
dth01120  Microbial metabolism in diverse environments
dth01130  Biosynthesis of antibiotics
dth01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_0069
  Lipid metabolism
   00071 Fatty acid degradation
    DICTH_0069
  Amino acid metabolism
   00350 Tyrosine metabolism
    DICTH_0069
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DICTH_0069
   00626 Naphthalene degradation
    DICTH_0069
Enzymes [BR:dth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DICTH_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ACI19306
UniProt: B5YAY3
Position
81674..82864
Genome map
AA seq 396 aa AA seqDB search
MKENLNFSYFIPTKIWFGPGSLEKLREEKLPGRKALIVISAGGSMKRLGYLDRLTDILKS
KGVEYVVFDKILPNPIKKHVMEGAQIAREEKCDFVIGLGGGSSIDSAKSIALMAKNDGDY
WDYIVGGTGKGKKPEKGALPIVAITTTAGTGTEADPWTVITNEETNEKIGYGNEYTFPTL
SIVDPELMLSVPPHLTAYQGFDAFFHAVEGYIANIATPVSDLYALKSVELIAKYLPVCVK
NGSDLTARTYVALANTLSGFVESTSSCTSEHSMEHALSAFHPELPHGAGLIMLSEAYHTF
FASKIPERYINLARAMGVDVDSLPEEERPFAFVKALKKLQEECGVANLKMSDYGIKEDEI
EKLAKNAMETMGGLFEMDRYKLSFEEVVEIMRKAYK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaatttaaatttctcctattttattcctactaagatatggtttggtccagga
agcttagaaaaattaagagaagaaaagctccctggtaggaaagcacttatagttatttct
gctgggggttccatgaaaagacttggttatcttgataggcttacagatattctaaaaagt
aaaggtgtagaatatgtagtttttgataaaattcttcccaatcctattaagaagcatgta
atggaaggtgctcaaattgcaagagaagagaaatgtgattttgtaattggacttggagga
ggaagtagtattgattcagcaaagagtattgcgttgatggcaaagaatgatggtgactat
tgggattatattgtaggtggtactggaaaaggtaaaaagccagaaaaaggagctttacct
attgtggctataaccactacagcaggtacaggaactgaggcagatccatggacagtaata
accaatgaggaaactaatgagaaaatcgggtatggtaatgaatatacttttcctactttg
tccattgtagatcctgaacttatgttgagtgttccccctcatcttactgcctatcaagga
tttgatgcctttttccatgcagtagagggctatattgcaaatattgcaactccagtgagt
gatctttatgctttaaagagtgtagaattgattgctaaatatttacctgtttgtgtaaaa
aatggtagcgatcttactgcaagaacttatgtggctcttgctaataccctttcaggattt
gtagaaagtacatcaagctgtacttcggagcattctatggagcatgctctttctgctttt
catccagagcttccccatggggcaggattgattatgctttcagaggcttatcataccttc
tttgcctcaaagattcctgaaaggtatataaaccttgcaagggcaatgggtgttgatgtg
gattctcttcctgaagaggagagaccttttgcttttgttaaagcactgaaaaagcttcaa
gaagagtgtggagtggcaaatttgaagatgtctgactatggtataaaggaagatgaaatt
gagaaattggctaagaatgctatggagactatgggcggactctttgaaatggataggtat
aagttaagttttgaagaagttgtagagataatgcgaaaagcttataagtaa

DBGET integrated database retrieval system