KEGG   Dictyoglomus thermophilum: DICTH_0505Help
Entry
DICTH_0505        CDS       T00774                                 

Definition
(GenBank) endoglucanase H
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00500  Starch and sucrose metabolism
dth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICTH_0505
Enzymes [BR:dth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     DICTH_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase DUF4038 Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: ACI19692
UniProt: B5YCX9
Position
503886..504884
Genome map
AA seq 332 aa AA seqDB search
MKKIVFLFLLVFFIFNINGYSQERLPIKRGVNLTGLEAPFEGSWGVYVKDEYFELVKKAG
FDHIRLPVRWNGHAAYEPPYTIRSYIFDRVDQIINLAFKNKLYVIINIHNYEEIMQNPEK
HKERFLALWKQIAEHYRNYPDSLWFELLNEPNTNLTPQLWNEYLAEAIKVIRETNPTRKI
VVDTANWANYSTISFLKLPEDKNLVVSFHYYNPFNFTHQGADWVQPQLPVGVKWTGSDQE
RKAIERELDFTVEWAKRNGNVPLYMGEFGAYHRADMESRVRWTDFVARSAEKRGIAWAYW
DFASAGFGVYDGLNKMWRMDLLKALIPDTKIK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattgtatttttatttttgttagttttctttatttttaatataaatggctat
tctcaggaaagacttccaataaagagaggagtaaatttaacagggcttgaagctcctttt
gagggctcttggggagtttatgttaaagatgagtattttgaattggttaaaaaggcaggt
tttgatcatataaggcttcctgtaagatggaatggacatgctgcttacgaacctccttat
accattaggagttatatttttgatagggtagatcaaataattaatcttgcttttaaaaat
aagttatatgtgataattaacattcataattatgaggaaataatgcaaaatcctgagaag
cataaagaaagatttcttgctctatggaagcaaatagcggagcattataggaattaccca
gatagtttatggtttgagcttttgaatgaacccaatactaatcttacccctcaactttgg
aatgagtatttagctgaagctattaaggtaataagagagactaaccctacaagaaagatt
gtggttgatactgctaactgggcgaattatagtaccatatcctttttaaaacttcctgaa
gataaaaatttagtggtaagttttcattactataatccttttaattttactcatcaaggg
gcagattgggttcaacctcaacttcctgtaggggtaaagtggacaggttctgatcaagaa
aggaaggctattgaaagggaactagattttactgttgagtgggcaaaaagaaatggaaat
gtacctctttatatgggggagtttggagcctatcatagggcagacatggaatcaagggtg
agatggacggattttgtagcaaggtctgcggagaaaagaggaattgcttgggcatattgg
gattttgcttcggcaggatttggtgtatatgatggattaaataagatgtggagaatggat
cttcttaaggctttgattcctgatacaaagataaaataa

DBGET integrated database retrieval system