KEGG   Dictyoglomus thermophilum: DICTH_0534Help
Entry
DICTH_0534        CDS       T00774                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00260  Glycine, serine and threonine metabolism
dth00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dth01100  Metabolic pathways
dth01110  Biosynthesis of secondary metabolites
dth01130  Biosynthesis of antibiotics
dth01230  Biosynthesis of amino acids
Module
dth_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DICTH_0534 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DICTH_0534 (trpB)
Enzymes [BR:dth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DICTH_0534 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP VapB_antitoxin
Motif
Other DBs
NCBI-ProteinID: ACI18280
UniProt: B5YD08
Position
534661..535863
Genome map
AA seq 400 aa AA seqDB search
MRKIELKNLPDERGYFGEFGGRFVPETLMEPLLQLEEAYNKYKNDERFKQELDYYLKTYV
GRPTPLYFARNLSEKLKAKIYLKREDLCHTGAHKINNAIGQALLAKYMEKKRLIAETGAG
QHGVATATVAALFGFKCTVYMGEEDCERQKINVLRMKLLGAEVIPVKVGSKTLKEAINEA
LRDWVAHPEDSYYLLGSVVGPHPYPVIVRDFQKIIGEEVKKQILELENRLPDYLVASVGG
GSNSIGLFYPFLEDDVKIIGVEGGGKGLESGLHSASINFGRVGVLHGAKMYLIQDENGNV
SPTHSISAGLDYPGVGPEHSFLAKIGRVKYDIATDDVALKGFLALSELEGIIPALESAHA
IGYVIEHRDEFPEKEPIIVINLSGRGDKDLEIISKYVGEK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatagagctgaaaaatcttcccgatgaaagaggatattttggagaatttgga
ggaaggtttgttcctgaaactttaatggagcctttgcttcaattagaggaggcatataat
aagtacaagaatgatgaaagatttaagcaggaattagattactatcttaagacttatgtg
ggtagacctactcctctttactttgcaaggaatctttctgagaaattgaaggcaaaaata
tacttgaaaagagaggatctttgtcatacaggggctcataagataaataatgctattgga
caggcactacttgctaaatatatggaaaaaaagagattaatagcagaaactggagctgga
cagcatggggttgctacggcaactgtggcagcactttttggattcaaatgtactgtgtat
atgggcgaagaggattgcgaaagacaaaaaattaacgttttaagaatgaaacttttaggg
gcagaggtcattcctgtaaaagtaggatcaaaaactttaaaagaggcaataaatgaagcg
ttgagagattgggtggcacatccagaagatagttattatcttttaggatcagtggtaggt
cctcatccttatcctgtaattgtaagagattttcaaaagataataggagaagaggtcaag
aagcaaatattagagttagaaaatagacttcctgattacttagttgcttctgtcggagga
gggagtaattctataggacttttttatccttttctggaggatgatgtaaagatcataggt
gttgaaggaggaggaaaaggcttggagtctggtttacattctgctagtatcaactttgga
agagtaggtgttcttcatggggctaagatgtatcttatccaagatgaaaatggaaatgtt
tctcctactcactccatatctgctggattagattaccctggagtaggaccagaacacagt
ttccttgctaagattggcagagtaaaatatgatattgctacagatgatgtggcgttaaaa
ggttttttggccctctcggagttggaaggaattattccggctttggagagtgctcatgcc
ataggttatgtgattgaacacagggatgaatttcctgaaaaggagcctattatagtaata
aacctttctggaagaggagataaagatttagaaataatatcaaagtatgtgggggagaaa
taa

DBGET integrated database retrieval system