KEGG   Dictyoglomus thermophilum: DICTH_0597Help
Entry
DICTH_0597        CDS       T00774                                 

Gene name
trxB
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    DICTH_0597 (trxB)
Enzymes [BR:dth01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     DICTH_0597 (trxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like GIDA FAD_binding_2 Thi4 DAO FAD_oxidored NAD_binding_7 K_oxygenase NAD_binding_8 MCRA FMO-like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACI19544
UniProt: B5YD71
Position
complement(602390..603361)
Genome map
AA seq 323 aa AA seqDB search
MDFISLTKPIEKIEEEQDVIILGGGPAGLTAGIYAGRNLWRTLIIEKAIVGGNAALTEKI
DNYPGFPEGITGEELVKRMEAQAKKFGSKILEADVLSLKIDGNWKIVETSNGVFRAPTLI
IATGTRPKKLGVPGEKEFIGKGVSYCAVCDGAFFTGKKVAVIGGGDSAVEEAIYLTKFAE
EVTIIHRRDTLRAEKINQQRAFSNPKIKFLWSHIVKAIEGEKKVEKLILEDLKTGETKIF
PVDGVFIYIGLIPNTELFKGILNLDSNGFIITDEKMHTSIPGIYAAGDVRGKILRQVVTA
VSDGAIAGMEASKFLEELNYKEV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggattttatatctttaacaaagcctatagaaaagattgaagaagaacaagatgtaatt
attttaggaggaggaccagcaggtcttactgcaggaatatatgctggaagaaatctgtgg
agaactcttataattgaaaaggcaatagtaggaggcaatgctgctctcacagagaaaata
gacaattatcctggttttccagaaggaataacaggagaagaattggtaaaaagaatggag
gctcaagcaaaaaaatttggttctaaaatattagaagctgatgtcttatccttaaaaata
gacggaaactggaaaatagttgaaacatcaaatggagtttttagggctcctactcttatt
attgctactggcacaagacccaagaaattaggagttccaggagaaaaagaatttataggg
aaaggtgtctcctactgtgcagtatgtgatggtgccttctttactggaaaaaaagttgct
gttataggtggaggagattctgctgttgaagaagcaatatatctaacaaagtttgctgaa
gaagtaacaattattcatagaagagatactcttagggccgaaaaaataaatcaacaaaga
gctttctctaatcctaaaataaaatttctatggagccatatagttaaagctatagaaggc
gagaagaaagttgaaaaattaatactagaagatttaaagacgggagagaccaaaatcttt
cctgtagatggtgttttcatttatataggcttaattccaaatacagaactttttaagggt
attttgaatttggattccaatggttttataataacagatgaaaaaatgcatacttctata
cctggaatatatgcagcaggagatgtaagaggtaaaattctaagacaagttgtaactgca
gtttctgacggagctatagctggtatggaagcaagcaagtttttagaagaattaaattac
aaggaggtttga

DBGET integrated database retrieval system