KEGG   Dictyoglomus thermophilum: DICTH_0602Help
Entry
DICTH_0602        CDS       T00774                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YdfA_immunity
Motif
Other DBs
NCBI-ProteinID: ACI19589
UniProt: B5YD74
Position
complement(606825..607814)
Genome map
AA seq 329 aa AA seqDB search
MSLLWGFLILILVLIFLGIFFSFVPLGLWISALAAGVSIKITDLIGMRLRRVPPGVIINS
LIKAHKAGLSEVTLDKLEAHYLAGGNVDKVVNALIAAQRAGIPLTFEKAAAIDLAGRDVL
EAVQMSVNPKVIETPVVAAVAKDGIELKAKARVTVRANIERLVGGAGEATIIARVGEGIV
TTIGSAESYKEVLENPDSISKTVLAKGLDAGTAFEIVSIDIADVDVGNNVGARLKMDQAE
ADMRIAQAQAESRRALAIAREQEMKALTQEMRARLIEAEKEVPLAVAEALRSGKIGVLDY
YTLKNIMADTAMREAISKLGQKEEEGRKD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagtttattgtggggctttttaattttaatcttagtattaatattccttggaatattc
tttagttttgtgccattaggattatggatttcagctcttgctgcaggagtttccatcaaa
attaccgatttgatcggaatgagacttagaagagtcccccctggagtaataataaactcc
ttaattaaagcccataaagctggactttcagaagtaactcttgacaaattagaagcccat
tacttggctggaggaaatgtagataaagttgttaatgctttaattgcagcccaaagagca
ggtatccccttaaccttcgaaaaggcagcagccatagaccttgctggaagagatgtatta
gaagcagtacaaatgagtgttaatccaaaggttattgaaactccagtggtagccgctgta
gcaaaggatggcattgaattaaaagccaaggcaagagtaactgtaagagccaatattgaa
agattagtaggaggagcaggagaagcaacaattatagcgagagtaggagaaggaatagta
actactattggatctgcagaaagttataaagaagttttagaaaacccagatagtatatca
aaaacagtacttgcaaagggacttgatgcaggaacagctttcgaaatcgtatccattgat
atagcagatgtagatgtaggaaataacgtaggtgcaagattaaaaatggaccaagcagaa
gccgacatgagaattgcacaagcccaagcagaaagtagaagagcccttgccatagcaaga
gaacaagaaatgaaagctctaacccaagaaatgagagcaagactaatagaggcagaaaaa
gaagttcctcttgctgtagcagaagctctaagaagcgggaaaataggagtactagattat
tatactttgaaaaacataatggcagatacagccatgagagaggctatttctaagcttgga
caaaaagaagaagagggaaggaaagactaa

DBGET integrated database retrieval system