KEGG   Dictyoglomus thermophilum: DICTH_0604Help
Entry
DICTH_0604        CDS       T00774                                 

Definition
(GenBank) hypothetical protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3488
Motif
Other DBs
NCBI-ProteinID: ACI19932
UniProt: B5YD76
Position
complement(609084..609548)
Genome map
AA seq 154 aa AA seqDB search
MENLVISRLRILTFLFIAVYLLPNSFFDDLRIWLLILFALLYSSIVYYFVAREKLQENLT
LSIIDLLIVFFYLFLINQMATKFVFLIYLPAIKEILYRRIKNAYIISFMGNLGVIVLSFI
LKENLPLEISLSLIPISFLIPYFSSSYIKEMEGS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaacctagtaataagtagactaagaattttaactttcttatttatagcagtttat
ttattaccaaacagcttctttgatgaccttagaatttggcttttaatactttttgcgctt
ctttatagttcaatagtatattattttgtggctagagaaaaactacaggaaaatttaaca
ttatccattattgatttgcttattgttttcttttatttatttctcataaatcaaatggca
acaaaatttgtatttctcatctatcttcctgccataaaagaaatcctttatagaagaatt
aaaaatgcctacataataagttttatgggaaatctaggagtaatagttttatcctttatt
cttaaagagaacttacccttagaaatttccctttcactaattcctatctcctttctcatt
ccctatttttcttcctcttatataaaagaaatggagggatcttaa

DBGET integrated database retrieval system