KEGG   Dictyoglomus thermophilum: DICTH_0607Help
Entry
DICTH_0607        CDS       T00774                                 

Definition
(GenBank) glycoside hydrolase, family 57
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57
Motif
Other DBs
NCBI-ProteinID: ACI18464
UniProt: B5YD79
Position
612904..615381
Genome map
AA seq 825 aa AA seqDB search
MGKLYVSFIWHMHQPYYKDTSKSLSIFPWVRFHGIKNYYNMVSILKDFPKIKQTFNFVPS
LLLQIQEYLDRRTTDLWLEKSLKKASELNMEDKKFILDNFFLLNKEKMGFIFPRFKELYY
KKLNNEEYTVQDFLDLQVLYNLAWFDPDLRKKDSFLIYLVEKGKNFTEEEKLKVIEKQFE
ILRGLFSLYRSMQDSGQIEVIFSPFFHPIMPLLIDTKSAKVSTPELPLPFDYFSFKEDAE
KQLFLGKEYYRKLFDKDPLGIWPSEQAVSPEFVEMVSEFNIKWFVSDERILFKSLGEDFL
RDNEEFINKPEILYKPYRINLNGKEVYAVFRDQVLSDRIGFVYMNYPPEDGAKDLYYRLL
KIKNSLPQNSDFLVTIALDGENCWEYYDNDGRDFLRNLYTLLSDSKELETITVKDFIEKT
KNFGELNNIFTGSWINADLTTWIGEIEENLAWEYLTITRKFVEKKKDRVDWISLMAAEGS
DWFWWYGDDQESGYDEIFDEIFRSHLKNVYRSINKAYPSFLDFPIVFRNPLWRSRRSLIF
TPKIDGIITSKDEWVLSSLNLLEEKKSEFITGIYYGYDLSNLYMRIDLMDKAEKYFNDDY
FIVINFYSRNKGSCKYRLDLRNELCGDNISLKIKDIVEVSIPWDKFTGFDRNSTIHFKVD
LCKNTEMVESLEDTENFWFEIPNLMDEIITKLFLFGDPSRKVELSTMLISRKKVYNLYSK
VSILQDSLKKDFVKIENKGEIIEVTKHISLRELLFLIQCVRDLKVFGILDKYVCAPVGRV
SKTEGIYVIEPKVFVHDFLKKYIEKEKLEVPIEMDKLGRIEIYGL
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttgtatgtaagttttatatggcatatgcatcaaccatattataaagacact
tctaaaagtttatccatattcccttgggttagatttcacggtattaagaactattacaat
atggtttccatactgaaagattttccaaagataaagcagacgtttaattttgttccatcc
ttacttttacaaatacaagaatacttggacagaagaactacagatttgtggttagagaaa
tctcttaaaaaagcctctgagttaaatatggaggataagaaatttattttagataacttt
ttcctccttaataaggagaagatggggtttatatttccaagatttaaagagttatactac
aaaaagttgaataacgaagaatacacagttcaggattttttggatttacaagttttatat
aatcttgcttggtttgatcctgatttgagaaagaaagattctttcttaatttatttggta
gaaaaaggcaaaaattttactgaagaggaaaaattaaaagttatagaaaagcagtttgaa
atcctaagaggacttttttctctttatagatcgatgcaggattctggacaaatagaagtg
attttttctcccttttttcatcctataatgcctcttttgatagacacaaagagtgccaaa
gtatctacgcctgagcttcctcttccttttgactatttttcttttaaggaagatgcagaa
aagcagcttttccttggaaaagaatattatagaaagttatttgataaagatcctttaggt
atatggccttcagagcaagctgtaagtcctgaatttgtagaaatggtctcagagtttaat
attaaatggtttgtttcagacgaaaggattctttttaaaagtttgggagaagatttctta
cgggataatgaggagttcataaataagccagaaatcctttataaaccttatagaataaat
ttgaatggaaaagaagtctatgcagtttttagagatcaggttctgtcagacagaattgga
tttgtctatatgaattatcctcctgaagatggggctaaggatctatattatcgtctttta
aaaataaaaaatagtctacctcaaaattcagattttcttgtaactattgctttagatggt
gaaaattgttgggagtattacgataatgatgggcgagatttcttaagaaacctatatact
ttactttctgattctaaagagcttgagacaataacggtaaaagattttattgagaaaaca
aaaaattttggagaacttaataatatttttactggatcctggataaatgctgatcttact
acttggattggagagatagaggagaatcttgcatgggaatatctaaccattacaaggaag
tttgtagagaagaagaaagatcgggtagattggataagccttatggcggcagaaggaagt
gactggttttggtggtatggagatgatcaagaatcaggatatgacgagattttcgatgaa
atttttaggtctcatcttaaaaatgtttatagatctattaataaagcttatccttctttc
cttgacttccctattgtttttagaaatccgttatggagaagtaggagatctttaattttt
actcctaagatcgatgggataattacctctaaagatgagtgggttttgtcgtccttaaat
ttgttagaagagaagaaaagtgaatttataacaggaatttattatggttatgacttaagc
aacttatatatgagaattgacttaatggataaggcagaaaaatattttaatgatgattat
tttatagttatcaacttttactcaagaaacaaaggtagctgtaaatatagattagattta
agaaatgagctttgtggggataatatttcattgaagataaaagatatagttgaggttagt
attccttgggataaattcacagggtttgataggaattcaacgatccattttaaggttgat
ttgtgtaaaaatacagagatggtagaaagtcttgaggatacagagaatttttggtttgag
attcctaatttaatggatgaaattattacaaaactatttctttttggggatccttctcga
aaggtcgaactttcgacgatgcttatttctaggaaaaaagtttataatctttattctaaa
gtaagtatattgcaagattctcttaaaaaagattttgtaaaaatagaaaataagggtgaa
atcatagaagttaccaaacatatttctctaagagagcttttattcttaatccagtgtgtc
agagatttgaaggtttttggaattttagacaaatatgtatgtgctcctgtgggtagagtc
agcaagacagaaggaatatatgtgatagaaccaaaagtttttgtacatgattttcttaaa
aagtatattgagaaggaaaaattggaagttcctattgagatggataaactgggaaggata
gagatatatggattatga

DBGET integrated database retrieval system