KEGG   Dictyoglomus thermophilum: DICTH_0612Help
Entry
DICTH_0612        CDS       T00774                                 

Definition
(GenBank) TldD protein
  KO
K03568  TldD protein
Organism
dth  Dictyoglomus thermophilum
Brite
KEGG Orthology (KO) [BR:dth00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dth01002]
    DICTH_0612
Peptidases [BR:dth01002]
 Peptidases of Unknown Catalytic Type
  Family U62
   DICTH_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PmbA_TldD
Motif
Other DBs
NCBI-ProteinID: ACI19002
UniProt: B5YD84
Position
617972..619360
Genome map
AA seq 462 aa AA seqDB search
MISKSIAEEILEISLSKGGDFSELFFEVSNSLYFYFDDNKLEEAVAGEDVGVGLRVILGD
RTFYGYTTDISLMGLRKLAKNLAEAVFQGDKDIKVVLSEKDEYGIRPLKDIGSFEIKEGK
DILKIMNEKARGYDSRIVQFTSVIRTVDQKILIANTEGDFIEDRRVRTAVYGLSVGSYNG
IIQTGYETVAGTVGWELLTEEVINKIPYEASRRAILLLEAKEAPAGVMPVVISSKAGGVL
IHEAVGHGLEADLVDKGVSVYKGKIGEKVASELVTMVDAGVLEGMYGSSAVDDEGVKTNY
NVLIDRGILKGYMHSRITAKKFNVRPSGNGRRQNFRYPPIPRMTNTFILPGESKVEDMLQ
RLERGIYVVKMGGGQVDTTSGDFVFGIEEGYLVINGEIKHPIRGATLIGNGPKILEKIEM
IGNDIGFAPGTCGKDGQGVPVTDGMPTLFISEITIGGTEKGE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgatatctaaaagcatagctgaagaaattcttgaaatttccttaagcaaaggtggagat
ttttcggaattattttttgaggttagtaattctctttatttttattttgacgataataag
ttagaggaagcagtagcgggagaagatgtaggagtaggtttaagggtaatattaggagac
agaactttttatggatatactactgatatttcattgatgggattgagaaaacttgccaag
aatttagcggaagctgtgtttcaaggagataaagatataaaagttgtcctatctgagaaa
gatgagtatggcataaggcctttaaaggatataggaagttttgagataaaagaaggaaaa
gatattttgaagattatgaatgaaaaggcaaggggttacgattcaaggatagttcaattt
acttctgtgataaggactgtagatcagaagattcttattgcaaacacagagggggatttt
attgaagataggagagtaagaactgcggtttatggactttccgttgggtcttataatgga
attattcaaacaggatatgagacggttgcaggtacggtaggttgggagctgcttactgaa
gaagttattaataaaatcccatacgaggcttcaagaagggctattctactccttgaagcc
aaagaagctccggctggagttatgccagtggttatatcttcaaaggctggaggtgttcta
atacacgaagctgttggacatggtcttgaagctgatttggttgataagggagtctcagtg
tacaaaggaaagattggagaaaaggtagcttcagagctggttactatggtagatgcaggt
gttcttgaaggaatgtacggctcttcagcagtggacgatgaaggagtaaaaactaattat
aatgttctaattgataggggtattttgaagggatatatgcattcaagaattaccgcaaaa
aagttcaatgttcgtccttcaggaaatgggagaagacaaaattttcgatatcctcctatt
cctcgaatgactaataccttcattcttccaggagaaagtaaagtagaagatatgttacaa
agattagagagaggaatatatgtggtaaagatgggaggaggtcaggtagatacaacctct
ggagattttgtttttggaattgaagagggttatcttgtaataaatggtgaaattaaacat
ccaataagaggtgcaacattaataggaaatggacctaagattttagaaaagattgaaatg
attggaaatgatattggttttgctcctggtacttgtggaaaagacgggcaaggagttcct
gtaaccgatggtatgcctactctttttatatctgagattactattgggggtacagagaaa
ggagagtaa

DBGET integrated database retrieval system