KEGG   Dictyoglomus thermophilum: DICTH_0615Help
Entry
DICTH_0615        CDS       T00774                                 

Definition
(GenBank) rubrerythrin subfamily
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rubrerythrin DUF2383 dDENN FA_desaturase_2
Motif
Other DBs
NCBI-ProteinID: ACI18540
UniProt: B5YD86
Position
620699..621178
Genome map
AA seq 159 aa AA seqDB search
MVKMFSSQDLIEMAIHIEEEGEKFYELMGSKVEDEELKKLFSYLALEEKRHALAFKEIYS
RLENEGFVSAYPDQEANKYLHAFVDSQIFIDWDKLSTRTVWSLSEVLDLAISLEKDSILF
YYEMEKYIPEKDKNILYEIIKQEKMHLSQLTEFKKGIKN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagatgttttcttctcaagatttaattgaaatggctatacacattgaagaagaa
ggagaaaaattttatgaattaatgggatcaaaggtagaagatgaagaattgaaaaaatta
tttagctatcttgctttagaagaaaaaagacatgccttagcttttaaggaaatttactct
cgtttggagaatgaaggctttgtttctgcttatcctgatcaggaagctaataaatatttg
catgcttttgtagattctcaaatttttattgattgggataagctttctacaagaacagta
tggagtttatcagaagtattagatcttgctataagtttagaaaaagactctattctcttt
tattatgaaatggaaaaatatattcctgaaaaggataaaaacatcctgtatgaaataata
aaacaggagaagatgcatctttctcagcttactgaatttaagaaaggtataaagaattag

DBGET integrated database retrieval system