KEGG   Dictyoglomus thermophilum: DICTH_0616Help
Entry
DICTH_0616        CDS       T00774                                 

Definition
(GenBank) thermostable DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth03030  DNA replication
dth03410  Base excision repair
dth03420  Nucleotide excision repair
dth03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dth00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DICTH_0616
   03410 Base excision repair
    DICTH_0616
   03420 Nucleotide excision repair
    DICTH_0616
   03430 Mismatch repair
    DICTH_0616
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dth03032]
    DICTH_0616
   03400 DNA repair and recombination proteins [BR:dth03400]
    DICTH_0616
Enzymes [BR:dth01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DICTH_0616
    6.5.1.6  DNA ligase (ATP or NAD+)
     DICTH_0616
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     DICTH_0616
DNA replication proteins [BR:dth03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    DICTH_0616
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     DICTH_0616
DNA repair and recombination proteins [BR:dth03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DICTH_0616
   NER (nucleotide excision repair)
    Other NER factors
     DICTH_0616
   MMR (mismatch exicision repair)
    Other MMR factors
     DICTH_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ACI19645
UniProt: B5YD88
Position
622170..623918
Genome map
AA seq 582 aa AA seqDB search
MLFGELAQYFERIEKTTKRNEMMEILADLFRKVDKEEIDKIIYLLNGRVAPDYEKIEFGM
SDKLVLRAMALALKIPLLELERSYKEVGDLGELVVKYSKNEGKDLTVVETFNTLYDIANL
SGEGSVDAKVNRLAFLINSLTPQGGKYLVRIVLGKLRLGVGEPTIMDALSFAKVKDKGLR
PFIERAFNITSDLGYVAKVFWEGGVEALKRIKVQVGRPIRMALAERVSRAEEIIKRLGKC
AVEPKFDGFRCQIHKKENSVRIFSRNLEDNTYMFPDLVEAVLKQFPDRDVIIEGEAISYN
PETGEFYPFQVTVQRKRKYNISEMVELYPLQLFAFDILYLDGEDTTSLPYIRRRQKLEEA
LVEGEKISITKNIITNDPKEIQSFFEECITEGLEGIVAKRLDAPYQAGMRNFNWIKLKRS
YQGHLADTVDCVILGYFKGRGHRAKFGIGALLVGVYDDERDLFKTIAKIGTGPTEEEWVK
FREILDEIKVEKRPNNVESFIEPDVWVEPKYVVVVQADEITRSPVHTCGRELDGLGYALR
FPRVQGFVREDKGPYDATTVKEILEMFRNQKKEKVEEDSDLL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgctttttggagaacttgctcaatattttgaaagaatagagaaaactactaaaaggaat
gagatgatggagattcttgcagatctttttagaaaagttgacaaagaagaaattgataaa
attatctacttgttaaacggaagagttgctcctgattatgaaaaaattgagtttggaatg
tcagataagttggttttaagagctatggccttagcattgaagattcctttattagagctt
gaaagatcttataaggaagtaggagatttaggagaattggtagttaagtattccaaaaat
gaaggaaaagacttaactgttgtagagacttttaacactttatatgatattgcaaacttg
tcaggtgaaggaagtgtagacgctaaggtaaataggcttgcttttttaataaactctttg
acacctcaaggaggaaaatatttagtaagaatcgttttgggtaaattaagacttggagtt
ggtgagccaacaattatggatgctttatcttttgcaaaagtgaaagataaaggtttgagg
cctttcattgagagggcttttaatattacttctgatttgggatacgtggctaaggtcttc
tgggaaggcggagttgaggcactaaaaaggataaaagttcaggtaggaagaccaataaga
atggctcttgcagaaagagtatcacgggcagaagagattataaaaaggcttgggaaatgt
gctgtagagcctaaatttgatggttttagatgtcagattcataaaaaggaaaatagtgta
agaattttctcgagaaatttagaagataacacatatatgtttccagatttggttgaagct
gttttaaagcaatttcctgatagggatgttattatagaaggagaggcgatatcatataat
ccagagacgggtgaattttatccatttcaagtcacagtgcagagaaaaagaaaatataac
atatctgaaatggtggaattatatcctttacagctttttgcctttgatatcctatattta
gatggagaagatacaacttctttaccttacataagaagaagacaaaaattagaagaagct
ttagtagaaggcgagaagatttctattactaaaaatataattactaatgatccaaaagaa
attcaatctttttttgaggagtgtattactgaaggcttggaaggaatagttgcaaaaaga
ttagatgctccatatcaggcaggaatgagaaactttaactggataaaattaaagagatct
tatcaaggacatctggcagacacggtagattgtgttatcttaggatattttaaaggaaga
gggcatagagctaagtttggaataggtgctcttcttgtaggagtatatgatgatgagaga
gatctttttaaaactatagctaaaataggtacagggcctacagaagaggaatgggtaaaa
tttagagaaatacttgatgaaataaaggtagaaaagaggcctaataatgtagagtctttc
attgaacctgatgtttgggtagagcctaaatacgtggtggtagttcaggcggatgaaata
acaaggagtcctgtacatacttgtggaagggaattagatggacttggatatgccttgaga
ttccctagggttcaaggatttgttagagaagataaaggtccatatgatgctactactgtg
aaagaaattttagagatgtttagaaatcaaaagaaagaaaaagtagaagaggactcagat
ttattatag

DBGET integrated database retrieval system