KEGG   Dictyoglomus thermophilum: DICTH_0625Help
Entry
DICTH_0625        CDS       T00774                                 

Definition
(GenBank) bifunctional GcaD protein (TMS protein)
  KO
K04042  bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00520  Amino sugar and nucleotide sugar metabolism
dth01100  Metabolic pathways
dth01130  Biosynthesis of antibiotics
Module
dth_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DICTH_0625
Enzymes [BR:dth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.157  glucosamine-1-phosphate N-acetyltransferase
     DICTH_0625
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     DICTH_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Hexapep Nop16 CofC CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACI19617
UniProt: B5YD90
Position
631188..632096
Genome map
AA seq 302 aa AA seqDB search
MDNFKVIILAAGQGKRMRTELPKVLHPLYENTILEFLLDTVETVFEKEYILVVSPKVKSY
LSFVSDKNIVIQDKPLGTGDAVKRTEVLLKDYDGDVLILPGDMPLIRGETLKKVCDFHRE
NSNACTVVTTILDNPLGYGRIIRDEKGNILKIVEEKDATEKEKEVKEINTSIYAFKWKPL
KEALMHLKNDNAQGEFYLTDVIEIFNKQKLKIGVIRVGSEEVLGANTQEELSIIRGILKK
RVNKNNMENGVIIVDPDKVVIGHKVVVENDVIVQPEVFIFGDYIIRKNSYIGPFSYINSK
SD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggataattttaaagttatcattttggctgctggtcagggtaaaaggatgaggactgag
cttccaaaggttcttcatcccctctatgaaaacaccatattggagtttttgcttgacact
gtagagaccgtttttgaaaaagagtatatattagttgtgagcccaaaagtgaaatcttat
ttatcttttgtttcggataaaaatattgtgattcaggataagcctttaggtacgggagat
gcagttaaaaggacagaggttttgttaaaagattatgatggagatgtgctaattctccct
ggagacatgcctcttataagaggtgagactttaaaaaaagtttgtgattttcatagagag
aattctaatgcttgtactgtggttacaacgattttagataatcctttggggtatggaagg
ataataagagacgaaaaagggaatattttaaaaatagtagaagaaaaggatgctacagag
aaagaaaaagaagtaaaagagataaatacttctatttatgcttttaagtggaagccattg
aaagaggccttaatgcatttgaagaatgataatgctcaaggtgaattttatttgactgat
gttatagaaatttttaataaacagaaattgaaaattggtgtaataagagttggttcagag
gaggttttaggggcaaatacccaagaagaattaagtattatacgtggtatactgaaaaaa
agggtaaataaaaataatatggagaatggggttataattgtagatcctgataaagtagta
attggacataaggttgtagtcgagaatgatgtgatagttcaacctgaagtttttatattt
ggggattatataataaggaaaaattcttatatcggtcctttttcttatataaattctaag
tctgattaa

DBGET integrated database retrieval system