KEGG   Dictyoglomus thermophilum: DICTH_0646Help
Entry
DICTH_0646        CDS       T00774                                 

Definition
(GenBank) conserved membrane protein YqhQ
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1385
Motif
Other DBs
NCBI-ProteinID: ACI18573
UniProt: B5YDB1
Position
651237..652121
Genome map
AA seq 294 aa AA seqDB search
MKSKKDLVGGQAVYEGVMMRKGIDIAVAVRDPDGQIVIKKERLQPYFKKWTQIPFLRGLM
ILMDSLFWGIKALNYSTQVAFKEEEKIDNNWEIGLALLLGFALFVVLFIVLPLLIVRPIE
RYISSQIIIRLLEGIVRLVIFVLYLFSITKIKEIYRVFQYHGAEHKTVFCYEAGEELTVE
NCRKYSRFHPRCGTSFLLVVMLVSIVVFAFLGQQPFLLRIISRILLIPVIFSLSYEIIRI
GSQHTDSWFWKIILTPGLWMQYFTTKEPDDYQLETAIVALKEVTEKEYASEVGS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaaaaaagatctggtaggcggacaggcagtatacgaaggagtaatgatgaga
aaaggtatagatatagcggttgctgtaagagaccctgatggacagattgtgatcaagaag
gaaagacttcaaccttattttaaaaagtggactcagattccctttttaaggggtttaatg
atattgatggattctcttttttggggtatcaaggctttgaactattctacccaagtggct
tttaaagaggaagaaaagattgacaataattgggaaattggtttagctttattacttggt
tttgctctttttgtagttttatttattgttctacctttgttaattgtgagacctatagaa
agatatatctcatcacagataattataaggttattagaaggaattgttaggcttgttatt
tttgtcctttatctttttagtataacgaagataaaagagatttatagagtgtttcagtat
catggtgctgaacataaaactgtcttctgttatgaggcaggagaggaattgactgttgag
aattgtagaaaatattctcgttttcatccaagatgtggtacttcttttctgcttgtggta
atgcttgtaagtatagttgtatttgcttttttgggacaacagcctttcttacttagaatt
atttcgcgaatacttttaatccccgtgatttttagtttatcttatgagataataagaata
ggatcgcagcatactgattcctggttctggaaaattattcttactcctggattatggatg
cagtattttactacaaaggaacctgatgattatcaacttgagacagctattgttgccttg
aaggaggtgacagagaaggaatatgcttcagaagttggttcttga

DBGET integrated database retrieval system