KEGG   Dictyoglomus thermophilum: DICTH_0650Help
Entry
DICTH_0650        CDS       T00774                                 

Definition
(GenBank) protein tyrosine phosphatase
  KO
K01104  protein-tyrosine phosphatase [EC:3.1.3.48]
Organism
dth  Dictyoglomus thermophilum
Brite
KEGG Orthology (KO) [BR:dth00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DICTH_0650
Enzymes [BR:dth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     DICTH_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LMWPc
Motif
Other DBs
NCBI-ProteinID: ACI18877
UniProt: B5YDB5
Position
655040..655483
Genome map
AA seq 147 aa AA seqDB search
MKIVFVCSGNTCRSPMAEYLFRDIVKKLNLSNIEVTSAGIFTYEGREPSYLSVKVMIERG
IDISSHRSRKLTFDLIKEASLIYTMTKDQLFVLGEMYPEFKNKILTLGEEDIEDPFGLDI
EKYREVRDKIEKAITKIVENLKERVVR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagtttttgtgtgcagtggaaatacatgtagaagtccaatggcagaatatctt
tttagggatattgtaaaaaagcttaatctctctaatatagaggtaacttctgcaggtatt
tttacttacgagggcagggaaccttcatatctttcagtaaaggtaatgatagagcgagga
atagatatatcttctcataggtctaggaagttaacctttgacttgattaaagaggcttct
ttaatttacactatgactaaagatcaattattcgtattaggggaaatgtatcctgagttc
aaaaataaaattttgactcttggagaagaggatattgaggatccttttggacttgatatt
gaaaaatatagagaagttcgtgataagatagaaaaagcaataacaaaaattgttgaaaat
ttgaaggagagggtagtaagatga

DBGET integrated database retrieval system