KEGG   Dictyoglomus thermophilum: DICTH_0652Help
Entry
DICTH_0652        CDS       T00774                                 

Gene name
glyA
Definition
(GenBank) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00260  Glycine, serine and threonine metabolism
dth00460  Cyanoamino acid metabolism
dth00630  Glyoxylate and dicarboxylate metabolism
dth00670  One carbon pool by folate
dth00680  Methane metabolism
dth01100  Metabolic pathways
dth01110  Biosynthesis of secondary metabolites
dth01120  Microbial metabolism in diverse environments
dth01130  Biosynthesis of antibiotics
dth01200  Carbon metabolism
dth01230  Biosynthesis of amino acids
Module
dth_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DICTH_0652 (glyA)
  Energy metabolism
   00680 Methane metabolism
    DICTH_0652 (glyA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DICTH_0652 (glyA)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    DICTH_0652 (glyA)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DICTH_0652 (glyA)
Enzymes [BR:dth01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     DICTH_0652 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase SapB_1 HCR
Motif
Other DBs
NCBI-ProteinID: ACI19421
UniProt: B5YDB7
Position
655923..657167
Genome map
AA seq 414 aa AA seqDB search
MRYLPEVDPEIYEAIKSEEYREEYHLELIASENFVSRAVLEAQGSVLTNKYAEGYPGKRY
YGGCMYVDKVEDIARERVKTIYGAEHANVQPHSGSQANMAVYFVVLNPGDNVLGMNLAHG
GHLTHGSPVNFSGKLYNFYFYGVDRDTEMINYDSVWNLAKEVKPKLIVAGASAYPRIIDF
EKFAQIAEDVGAYFMVDMAHIAGLVAAGLHPSPVPYAHFVTSTTHKTLRGPRGGFILCKK
EFAKEIDKAVFPGIQGGPLMHVIAAKAVAFKEAMTPEFKEYQKQIILNAKAMAEELMRLG
YRLVSGGTDNHLMLVDLRDKGITGKEAEKALEEAGITVNKNAIPFDPQPPTVTSGIRIGT
PALTTRGMKEDEMRYVARLIHEVLSNFKDSKVKEKVKKEVEELCKQFPIYRKEN
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtatttaccagaggttgatcctgaaatttacgaggccattaagagtgaggagtat
agagaagaatatcatttagaacttattgcttctgaaaattttgtgagtagagctgtttta
gaggctcaaggttctgttcttaccaataaatatgctgaaggttatcccggaaagaggtat
tatggtggatgtatgtatgtggataaggtagaagatatagcaagggagagagtaaagaca
atatatggagctgagcatgctaatgtacaaccccattcaggtagccaagccaatatggct
gtttattttgtggttttaaatcctggagataatgttctggggatgaatcttgctcatggt
ggacacttgacgcatggaagtcctgttaatttttcaggaaagttatataatttttatttt
tatggcgtagatagagatacggaaatgataaattatgattcagtttggaacttggcaaaa
gaggtaaaacctaagctaatagttgctggtgcaagtgcttatccgagaattatagacttt
gaaaaatttgctcaaatagcagaggacgtaggtgcttatttcatggtagacatggctcat
atagctggacttgttgctgcaggattgcatccatctcctgttccttatgcgcattttgtt
acgagtactactcataaaaccttaagaggaccgaggggtggatttattttatgtaaaaaa
gaatttgccaaggaaattgacaaggcagtgttcccaggaattcaaggaggacccttgatg
cacgtgatagctgctaaggcagtagcctttaaagaagcaatgacccctgaatttaaggaa
tatcagaagcagataattttaaatgcaaaggctatggcagaagaacttatgagattagga
tatagacttgtgagtggtggaactgacaatcatctcatgctggtagatctgagggataag
ggaataactggaaaagaggcagagaaagctctggaggaggctggtataactgtgaataag
aatgcaataccttttgatcctcaacctcctacagtaactagtggaattaggataggtact
cctgcattaactactcgtggaatgaaagaagatgagatgagatatgtagcaaggttgatt
catgaggttctttcaaactttaaggatagtaaagtgaaagaaaaggttaaaaaagaagta
gaagaactttgtaaacaatttccaatttatagaaaggagaattaa

DBGET integrated database retrieval system