KEGG   Dictyoglomus thermophilum: DICTH_0653Help
Entry
DICTH_0653        CDS       T00774                                 

Gene name
upp
Definition
(GenBank) uracil phosphoribosyltransferase
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00240  Pyrimidine metabolism
dth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    DICTH_0653 (upp)
Enzymes [BR:dth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     DICTH_0653 (upp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPRTase Pribosyltran DUF3263
Motif
Other DBs
NCBI-ProteinID: ACI18965
UniProt: B5YDB8
Position
657171..657794
Genome map
AA seq 207 aa AA seqDB search
MVIVVDHPLVQHKLTKLRDKNTGPKEFRELLFEISSLMLYEVTKNLPTKEVEVETPLGIA
KGKVLDNKDLAIVPILRAGLVMADGMLQILPSAKVGHIGLYRDPETLKPVQYYTKLPEDI
DKREVIVVDPMLATGGSAVAAISILKAKGVKDIKFVCIISAPEGIETLRNSHPDVDIYTA
AIDERLNDHGYIIPGLGDAGDRLFGTK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggttatagttgtggatcatcctttagttcagcataagctgacaaaacttagagataaa
aacacaggtcccaaagaatttagagagcttctttttgaaatctctagtcttatgttatac
gaggtcacaaaaaatttgcctacaaaggaggtagaggtagaaactcctttaggtatagca
aagggaaaagttttagataataaagatttagctattgttccaatcttaagggctggactt
gtaatggctgatggtatgttgcaaattcttccttcggcaaaagtgggacatattggactt
tatagagatcctgaaactttaaaacctgttcaatattatacaaagcttcccgaggatata
gataagagagaggttatagttgtagatcctatgcttgccactggtggttctgcagtggca
gctatttcaattttaaaggctaaaggagttaaagatattaagttcgtatgtattataagt
gctccagagggaatagagactttaagaaatagtcatcctgatgttgatatatatactgct
gctatagatgaaaggttaaatgatcatgggtatattataccggggttaggcgatgcagga
gataggctctttggaacaaaatga

DBGET integrated database retrieval system