KEGG   Dictyoglomus thermophilum: DICTH_0659Help
Entry
DICTH_0659        CDS       T00774                                 

Definition
(GenBank) cationic outer membrane protein, putative
  KO
K06142  outer membrane protein
Organism
dth  Dictyoglomus thermophilum
Brite
KEGG Orthology (KO) [BR:dth00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    DICTH_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpH SurA_N_3 SurA_N_2 HemX ABC2_membrane_3 MerR-DNA-bind DUF148 Apolipoprotein Tho2 FapA DUF948 RRF ApoLp-III RasGAP_C HIP1_clath_bdg DUF5344 Syntaxin_2 Fib_alpha DUF4407 Pepsin-I3
Motif
Other DBs
NCBI-ProteinID: ACI19543
UniProt: B5YDC4
Position
668357..668824
Genome map
AA seq 155 aa AA seqDB search
MKKYGFLALVLLISVAFVFVGLKIVGAQTQQPKIAYIDEDKLLRNYQPFMNAYNKYQQEY
QDRLNKIAEAQKAGKSQDEIKKLSDQYDKELEPYKQAVQKVLENLRKTLDGIFADLSKKE
GYIAVLTKSVQGQDVVIWGGVDITDKVIKILSGSK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatggatttttagctttagttctattaatctcagtagcctttgttttcgtt
ggtttaaagattgttggagcacaaactcaacagcccaagatagcctatattgatgaagat
aaacttcttagaaattatcagccctttatgaatgcttacaataagtatcaacaggaatac
caagataggttaaataagatagcagaggctcaaaaggcaggaaagtctcaggatgaaatt
aaaaagttgtcagatcagtatgataaagaattagaaccttacaaacaggcagtacagaag
gtattggaaaatttgagaaagactttagatggtatttttgctgatctttctaaaaaagag
ggatatatagcagttctaaccaagtccgttcaggggcaagatgtagttatatggggtggt
gttgatattacagataaagtcataaaaatactttcaggtagtaaatag

DBGET integrated database retrieval system