KEGG   Dictyoglomus thermophilum: DICTH_0661Help
Entry
DICTH_0661        CDS       T00774                                 

Gene name
lpxD
Definition
(GenBank) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
  KO
K02536  UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00540  Lipopolysaccharide biosynthesis
dth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DICTH_0661 (lpxD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dth01005]
    DICTH_0661 (lpxD)
Enzymes [BR:dth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     DICTH_0661 (lpxD)
Lipopolysaccharide biosynthesis proteins [BR:dth01005]
 Lipid A
  DICTH_0661 (lpxD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep LpxD Hexapep_2 Fucokinase
Motif
Other DBs
NCBI-ProteinID: ACI19850
UniProt: B5YDC6
Position
669262..670275
Genome map
AA seq 337 aa AA seqDB search
MLLSEIAKIIGGELTGEDMEIEKVAEWESATERDLVFVFKSKDVAEIEDKTRARSLVIPS
DGKAKKTHIKVEDPKLAMAKILKFFDFRVYPSGIHNTAVLGNNVELGENTGIGAYVVIGN
NVKIGAGTKIFPGVVIGNNVEIGENCIIYPRNTIYDHVIIGNNVIIHSGCSIGVDGFGYV
WDGKEHFKITHIGKVIIEDNVEIGGNTVIERATLGETRIGKGTKIGSLIMIGHNVKIGEN
CVIVSQSGIAGSSILGNGVIMAGQSGVSDHVKVGNNVVILAKSGVTKDVPDNTVVSGFPA
RPHSEEMKVQAILRKLPELWEEIRKLREKIGQTGNNK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcttcttagcgagattgcaaagattattgggggagaattaactggtgaggatatggag
atagaaaaagtagcagagtgggagtctgctacagagagggatcttgtctttgtttttaaa
agtaaagatgtggcagaaatcgaagataaaacaagggcaaggtctctcgtgattccttct
gatgggaaagcaaaaaagacccatataaaagttgaggatccaaaacttgccatggcaaaa
attctaaagttttttgattttagagtttatccatcaggtattcataatactgctgttttg
ggaaataatgtggaacttggggaaaatacaggtataggagcctatgtggttatagggaat
aatgtaaagataggggcaggaaccaaaatttttccaggggtagtaataggaaataacgta
gagattggggaaaattgtattatttatcctcgtaatactatttatgatcatgtaataatt
gggaataatgtgataatccattcgggttgtagcattggcgtcgatggttttggatatgtt
tgggatggaaaggaacattttaaaattactcatatagggaaagtaattattgaagataat
gtggaaattggtggaaatacagtaatcgaaagagcgactttaggagagactcgaatagga
aagggcactaaaataggatcattgataatgataggacataatgttaagatcggtgaaaat
tgcgttatagtaagccaaagtggtatagcaggaagtagcattcttggaaatggtgtaata
atggcaggacaaagcggtgtttctgaccatgtaaaggtgggaaataatgtagtaatttta
gcaaagagtggtgtaacgaaggatgtgcctgataatacagtagtctcaggttttcctgca
aggcctcatagcgaagagatgaaagttcaggcaattttaaggaaacttcctgaactttgg
gaagaaataagaaagttgagggaaaaaattgggcaaacaggcaacaataagtaa

DBGET integrated database retrieval system