KEGG   Dictyoglomus thermophilum: DICTH_0665Help
Entry
DICTH_0665        CDS       T00774                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00540  Lipopolysaccharide biosynthesis
dth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DICTH_0665 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dth01003]
    DICTH_0665 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:dth01005]
    DICTH_0665 (lpxB)
Enzymes [BR:dth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     DICTH_0665 (lpxB)
Glycosyltransferases [BR:dth01003]
 Polysaccharide
  Bacterial polysaccharide
   DICTH_0665 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:dth01005]
 Lipid A
  DICTH_0665 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB Glyco_trans_4_2 Glyoxalase
Motif
Other DBs
NCBI-ProteinID: ACI18727
UniProt: B5YDD0
Position
672283..673374
Genome map
AA seq 363 aa AA seqDB search
MKIFLSALEVSADIHGAKLINALKNKAKNIYFYGLGGERMKEEGMEVLYDVTQYSTVGFV
EPIPYIPKLLLVQERVKRIIKETKPDLIIFIDAQGFNLPLAKYAKKLGLKTIYYFAPQYW
LWGDKKKVKEVLDSLSYVIATFPQEYELYRSFGDNVVYYGHPLVDYLLPYKDLEREKNII
GLFPGSRIQEIKNLTPIFLEIADRLKVNGYRFVMPIASEKFSNLVFEYVRGKDHIELVSG
KESQKYLKISSLSLVASGTVTLEAAILKTPAMVFYKISPVTYHIAKRLVHYTFIALPNII
LNQMIYPEFIQKIDIEEVMTNIGRILKDDIYRKNLEDKLKELETKLGQPGVLDRISNFIL
EII
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatttctatcggcattagaggtttcggctgatattcatggtgcaaaattaata
aatgcattaaaaaacaaagctaaaaatatatatttctatggacttggtggagagaggatg
aaagaagaagggatggaagtattatacgacgtaactcaatatagtactgttggttttgta
gaacctattccttatattccaaaacttttattagttcaagaaagggttaaaaggataatt
aaggagacgaaacctgatttaataatttttatagatgctcagggatttaatttgcccctt
gcgaaatatgctaaaaaattaggtttgaaaacaatctattattttgctcctcaatattgg
ctttggggagataagaaaaaggtaaaagaggtcttagatagtctctcttatgttattgct
acttttcctcaagaatatgaattatatagaagctttggagacaatgtagtatattatggt
catcctctggtagattatctactgccctataaagatcttgaacgggaaaaaaatatcata
ggacttttcccaggcagtagaattcaagagattaaaaatttgactcctatttttttagag
atagctgatagattgaaagtaaatggatacagatttgtaatgcctattgcctctgaaaaa
ttctctaatttagtttttgagtatgtaaggggcaaagatcatatagaattagtttctgga
aaagagagtcagaaatatttaaagatttcatctttgagtcttgtggcttctggtactgta
accttagaggcagctattttaaaaactcctgctatggttttttataaaatctctcctgta
acttatcatattgctaaaagacttgttcactatacctttatagcactgcccaatattatt
cttaaccagatgatttacccggaatttattcagaagattgatatagaagaagtaatgact
aatataggaagaattttaaaggacgatatttatagaaaaaatttagaagataaattaaaa
gagttagagactaagttaggacaacctggagttttggacagaatttcaaactttatttta
gaaataatatga

DBGET integrated database retrieval system