KEGG   Dictyoglomus thermophilum: DICTH_0667Help
Entry
DICTH_0667        CDS       T00774                                 

Definition
(GenBank) ATP-binding protein of ABC transporter
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:3.6.3.-]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dth00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DICTH_0667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dth02000]
    DICTH_0667
Enzymes [BR:dth01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     DICTH_0667
Transporters [BR:dth02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    DICTH_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N Zeta_toxin AAA_24 AAA_16 RsgA_GTPase AAA AAA_29 MMR_HSR1 SbcCD_C Roc ABC_ATPase
Motif
Other DBs
NCBI-ProteinID: ACI18500
UniProt: B5YDD2
Position
674449..676188
Genome map
AA seq 579 aa AA seqDB search
MKYLARLFKLIKPYWGYFILGLFCILVGNGAQLYAPKFLGELLDQLSNVKDLAVLNRLSL
IIILLLFLRSLFLYGQIYIFSFIGHRVVADLREKLFSKIQYLSLDYLNRWNSGDLIARTL
QDTQLIQTSFLSGIADLFYAIVLLLGVLIIVVLTDWQLALATFLVIPLFVFSISGIGKEI
QKWSLAVQRKIADLTRIIQESIKGARVVRVFSQEETEIKRFKEENEKNFFRNLKIARLTA
IQIPLSSFLSALALVFILWLGTRKIAKGEMTLGTFVAFLTYVGMAIDPTQTILRVLAGLR
QAYAALERIFEVLEMGKEVLEVKNPIVLPPIKGFVEFDNVSFTYDGINWVLKDINLKVRA
GEKIAIVGSSGAGKTSLVNLIPRFIDPTKGVVRIDGYDIRKVSLKSLRSQIGFVPQETII
FHGTVRDNISYGNPYVSFEEIVEAAKMARAHDFIMKLPQGYDTIIGEGGINLSGGQAQRI
AIARTILLKPRLIILDEATSALDSESEAFVQEALEELMRGKTAFIVAHRLSTIKRADRIV
VLENGEIVEEGTHEELLKLGGVYLRIIKWQLEESKDKNE
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttagcaagattatttaaattaataaaaccttattggggatattttatatta
ggtcttttttgtattctagttggtaatggggctcaattgtatgctcctaaatttttagga
gaacttttagatcagctttctaatgttaaagatcttgctgtccttaatagactttcgcta
ataattatacttcttcttttcttaagaagtttatttttatatggacaaatttatattttc
tcttttataggtcatagagttgttgcagatcttagggaaaagcttttctccaaaattcaa
tacttatctcttgattatttaaatcgatggaatagtggagatctcattgcaagaacttta
caagatactcagctaattcagacatctttcctctcaggtatcgcagatcttttttatgct
attgtactcctcttgggagtattaataattgtagtacttactgattggcagcttgctctt
gctacttttcttgttattcctctttttgtcttttctatatcaggaatagggaaggaaatt
cagaaatggtctttggctgtccagagaaagattgcagatcttacaagaataattcaagaa
agcattaaaggagcaagagtagttagagtattttctcaagaagagacggagattaaaagg
tttaaggaagagaatgagaagaatttttttagaaacctaaagatagcaaggcttactgcc
attcaaattcctctctctagctttttaagtgctttagcacttgtttttattctatggctt
ggaacgagaaaaattgccaagggagagatgactcttggaacttttgtggcttttttaact
tatgtaggtatggctattgatcctacacagactattttgagagttttagcgggattaaga
caggcatatgctgctttagaacgaatctttgaggttttggagatgggcaaagaagtatta
gaggtaaaaaatcctattgttcttccacctataaagggttttgtagaatttgataatgtt
tcctttacttatgacgggattaattgggtgttaaaagatataaatcttaaagttagagct
ggagaaaaaattgccattgtaggaagtagcggagcagggaaaacttctttagtaaatctg
ataccacgttttattgatccaactaaaggggtagtaaggatagatggatatgatattaga
aaagttagtcttaaatctttaagatcacaaattggttttgtaccccaagagacaattatt
tttcatggtacagtgagggataatataagttatggaaatccgtatgtttcctttgaggaa
attgtagaggctgcaaagatggcaagagctcatgattttataatgaaattacctcaagga
tacgatactataattggtgaaggaggaattaatttatcgggaggacaagctcagagaata
gctattgcaagaactattcttttaaaacctcgattaattattcttgatgaggctacatct
gctcttgattcagagtctgaggcttttgttcaagaggctcttgaggagctgatgagaggg
aaaactgcttttattgttgctcataggctttcaactattaaaagagctgacagaattgtg
gtacttgagaatggagaaatagtagaagaaggtacccatgaagagctcttgaaattggga
ggagtttatctgagaataataaaatggcaattagaggagagtaaggacaaaaatgaataa

DBGET integrated database retrieval system