KEGG   Dictyoglomus thermophilum: DICTH_0668Help
Entry
DICTH_0668        CDS       T00774                                 

Definition
(GenBank) oxidoreductase, Gfo/Idh/MocA family
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA Semialdhyde_dh GFO_IDH_MocA_C RuvA_N UDPG_MGDP_dh_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACI19588
UniProt: B5YDD3
Position
676181..677128
Genome map
AA seq 315 aa AA seqDB search
MNKVKVGVIGVGYLGQHHVRIFSEIPQVELLGVCDINLKRAKEIASIYNIPFVTDDYRDL
IDKVEAVSIVTPTISHFQIAKDFLEKGIHTFIEKPVTYNLREAEILLDIASGKDLVLQVG
HIERFNPAVQELKKYIKNPFYIEARRMGPFDGRSTDVGVVMDLMIHDLDILFYILGKNRK
IIDINGVGYSIYTPHEDFATVNILFEGDIFVNLIASKVSPKKLRKLDIHEKSGDQIIVDY
IEQSISIVHGGAQHIESSLESPVLEREEPLRLELEHFVKCILEGKDPEVTLEDGKLALAL
ATEILKELKVFDFKR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggtaaaagtaggagttataggtgtaggttatttaggacaacatcatgtgaga
atctttagtgagattccccaagtagaacttttgggggtatgtgatataaatcttaaaagg
gctaaagaaattgcttctatatataatataccctttgtgactgacgattatagagatctc
attgataaggtagaggctgtaagtattgttactccaacaatttctcattttcagatagcg
aaagattttcttgagaagggcattcatacctttattgaaaagcctgttacgtataactta
agggaagcagagatattgttagatatcgcgagtggaaaagatttagttttacaggtagga
catattgaaagatttaatcctgcagtacaggaattaaaaaagtatataaagaatcctttt
tatattgaggcaaggagaatgggaccttttgatggtaggtctaccgatgttggggttgtt
atggatcttatgatacatgatttagacattcttttttatattcttggaaagaatagaaaa
attattgatataaatggagtaggttattctatttatactcctcatgaagattttgcaaca
gtgaatatcctttttgaaggggatatatttgtaaatcttatagcaagtaaagtttcacct
aagaagttaagaaaactcgatattcatgaaaagagtggagatcaaataattgtagattat
attgaacagagtatatctatagttcatggaggagctcagcatattgagtctagtttagag
tcaccggttttagaaagagaagaaccattgagattggaacttgaacattttgtaaaatgt
attttggaggggaaagatcctgaggttactcttgaagatggtaagttagcattagcgctt
gctacagaaatattgaaggagttgaaggtttttgattttaagaggtag

DBGET integrated database retrieval system