KEGG   Dictyoglomus thermophilum: DICTH_0670Help
Entry
DICTH_0670        CDS       T00774                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K06861  lipopolysaccharide export system ATP-binding protein [EC:3.6.3.-]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dth00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DICTH_0670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dth02000]
    DICTH_0670
Enzymes [BR:dth01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     DICTH_0670
Transporters [BR:dth02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00320]
    DICTH_0670
 Other Transporters
  Pores ion channels [TC:1]
   DICTH_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_14 SbcCD_C AAA_19 AAA_23 AAA_29 T2SSE DUF87 AAA AAA_30 AAA_24
Motif
Other DBs
NCBI-ProteinID: ACI19322
UniProt: B5YDD5
Position
677776..678495
Genome map
AA seq 239 aa AA seqDB search
MSLETVGIYKYYGKRCVVRNVSLTVDPGYVVGLLGPNGAGKTTTFYTIMGEVYADGGKVI
LDGEDITYLSMPQRARKGIGYLAQDPTIFRKLTVEENIKLVLELTNLTPKEQKKKLEELI
DEFQLHKVRKNLGYTLSGGERRRVEIARVLALSPRYILLDEPFAGVDPITVQNLQETIYY
LKDKGLGILITDHNVRDTLAITDYAYIIFSGEVLISGTPGEIISSDIAKRFFLGERFNL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagtttggaaactgttggcatttataaatattacggcaaaagatgtgtggttagaaat
gtatcccttactgtagatcctgggtatgtagttggccttctaggtcctaacggggctggt
aagactactactttctatactatcatgggagaggtttatgctgatggtggaaaagtaatt
ctcgatggtgaagatattacttatctttctatgcctcaaagggcaagaaaaggcataggc
tatcttgctcaggatcctacaatttttaggaagctcactgtggaagagaatattaaatta
gttttagaacttaccaatttaacgcctaaagagcaaaagaaaaaacttgaggaattaatt
gatgaatttcaactccataaagttaggaaaaatttaggttataccttgtcgggtggggaa
agaagaagggtagagatagcaagggttttagctttatcgcctaggtatatacttcttgat
gaaccctttgcaggggtagatcctatcacagtacagaatcttcaagagactatttattat
ttaaaagataaaggacttgggattcttataacagatcataatgtacgagacacattagct
ataacagattatgcttatattatcttttcgggagaggttctgatctcaggaactcctggg
gaaataattagtagtgatattgcaaaaagattctttcttggggagaggtttaatctttga

DBGET integrated database retrieval system