KEGG   Dictyoglomus thermophilum: DICTH_0676Help
Entry
DICTH_0676        CDS       T00774                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00330  Arginine and proline metabolism
dth00332  Carbapenem biosynthesis
dth01100  Metabolic pathways
dth01130  Biosynthesis of antibiotics
dth01230  Biosynthesis of amino acids
Module
dth_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DICTH_0676 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    DICTH_0676 (proB)
Enzymes [BR:dth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     DICTH_0676 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Skp1
Motif
Other DBs
NCBI-ProteinID: ACI19614
UniProt: B5YDE1
Position
683955..685070
Genome map
AA seq 371 aa AA seqDB search
MNDWKRIVVKVGTSSITDERGNPSGEKILSLVRECVKLMRANKEVVLVSSGAIASGREIM
QKLSKRKDLPAKQALSAVGQVRLMQYYSQLFSIFKQPIAQILLTAEDLRDRKRYINISQT
FETLIEEKVVPIVNENDTVAVEEIKIGDNDTLSAKVACAINADLLVILSDVEGLYSEDPN
LSPNAVLIRDIYEIDEKIEKIAGPGKGTGGMYTKVQAAKIVTEAGIPMILAKADLENVLE
RIVLKKEKVGTMFYPVERHLNRRKHWMLFMAKPQGKVYIDDGAKDALLKKGKSLLPVGVK
KIEGEFVRGDTVSILDLTGEEIGRGITNYDSSELERIKGKNTEEIKNILGEDFYEEVIHR
NNLVLINRGDS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattggaaaaggattgtggtaaaagtaggtacttcaagtattactgatgagagg
ggaaatccttctggagaaaagattttgtcattagttagggaatgtgtaaaacttatgaga
gctaataaggaggtagtgcttgtatcgtcaggtgctattgcctctggcagagaaataatg
cagaagctctctaaaaggaaagatcttcctgcaaaacaagctctttcggccgttggacaa
gtaaggttgatgcagtattattctcagcttttttctatatttaaacagcctattgctcaa
atacttcttactgcagaagatctcagagataggaaaaggtatataaatatctctcaaacc
ttcgagacattaatagaagaaaaagttgtaccaattgttaatgagaacgatacagtagct
gtggaagaaataaaaataggtgataacgatactctttcggcaaaggtggcttgtgctatt
aatgcagatcttcttgtaatcttatccgatgtggaaggattgtattcggaagatcctaat
ttatcacctaatgctgtattaataagagatatctatgaaattgatgaaaaaatagagaag
atagctggtccaggaaaaggtactggtggaatgtatactaaagtacaagctgctaagata
gtaacagaggcgggtattcctatgattcttgcaaaagcagatttagaaaatgttcttgag
agaatagttctaaaaaaagaaaaagttggaacgatgttttatccagtagagaggcatcta
aatagaaggaagcattggatgctttttatggcaaaacctcagggaaaagtatatatagat
gatggggcaaaagatgctctattgaaaaagggtaaaagcttgcttcctgttggagttaaa
aagatagaaggagaatttgtaagaggagatacggtaagtattttagatcttactggagaa
gaaattggacgtgggataacgaattatgatagttctgaattggaaaggataaagggtaaa
aatactgaggaaataaaaaatattttaggtgaggatttttacgaggaagtaattcataga
aataacttggtattaataaaccgaggggactcttaa

DBGET integrated database retrieval system