KEGG   Dictyoglomus thermophilum: DICTH_0692Help
Entry
DICTH_0692        CDS       T00774                                 

Definition
(GenBank) riboflavin transporter
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECF_trnsprt ECF-ribofla_trS YqgB
Motif
Other DBs
NCBI-ProteinID: ACI19193
UniProt: B5YDF7
Position
complement(699421..699954)
Genome map
AA seq 177 aa AA seqDB search
MATKKLVLVSILTALSIILSITIYFPILPQAPYLLYDPGDISLILISTQIGVPYGLLSTL
IVAILMAVFTGQGGPIGALMHFLASGTLVSVAGYVYKKTKNLILGLVLGTISMAIVMAIA
NIIFTPIYLGVPRSTIYPLILPVIIPFNLIKAGINSIISYLLISISSIRTYFERMRE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaaaaaacttgtattagtatcaattcttacagcattatcaatcattctttct
atcactatctattttcctattcttcctcaagcaccatatctactttatgacccaggcgat
atttctttaatcttaatatcaacccaaataggagtaccttatggactactttcaactctt
atagtagcaatattaatggcagttttcacaggacaaggaggaccaattggagctctaatg
cactttttggcttctggtactctagttagcgttgccggatatgtttataagaaaactaaa
aatttaatattaggccttgttcttggaaccataagcatggctatagttatggctatagca
aatattatttttactcccatatatttgggagtaccaagaagtactatttatccactgatt
ttaccagttataattccttttaacctgataaaggcaggaataaactccataatatcctat
ttgttgatatcaatatcttctattaggacttattttgaaaggatgagggaatag

DBGET integrated database retrieval system