KEGG   Dictyoglomus thermophilum: DICTH_0693Help
Entry
DICTH_0693        CDS       T00774                                 

Definition
(GenBank) permeases of the drug/metabolite transporter (DMT) superfamily
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA SLC35F DUF1129
Motif
Other DBs
NCBI-ProteinID: ACI19179
UniProt: B5YDF6
Position
698580..699452
Genome map
AA seq 290 aa AA seqDB search
MRYDELKGLLILTLITFVWGSTFSFTKIALEVFTPFFLLFLRFLLGAFALFLFLILKRQR
ISINFSGVILGIINFSAIAFQTFGLRYTTATKTAFITGLSVLLVPFFEKLVFKNKIYWNL
WLAVFTGFIGLIFLTTDFSSISTINWGDFLVLVCAVLYAIQIVYISYVVERREIFDLAFS
EILFTAIFSFLFFLIFEPRNLPLNFILKNSLSVIYLGIGATAFTLTLQLVGQKYVSPTKS
ALIYNLEPVFATLFAFLLLSEKLNFQQIIGASLILISLFISIPSSFQNKS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatgatgagttaaagggattgcttattcttacattaataacttttgtttggggt
agtactttttcttttacaaagattgctcttgaagtatttactccatttttcttgcttttt
ttaaggtttctacttggagcttttgcattatttctgtttctgatattaaaaaggcaaagg
atttctataaatttctcgggtgttatcttaggaattataaactttagtgctatcgctttt
caaacctttggtcttagatataccactgctactaaaacagcttttattactgggctttcg
gtccttttagtgcctttttttgaaaaattagtttttaaaaacaaaatttattggaatctt
tggttagctgtatttacaggatttataggacttatctttttaaccacagatttttcatcg
atctctacaattaattggggagatttcctggttttagtttgtgccgttctatatgctatt
cagattgtatatatctcttatgtagtggagcgcagagagatatttgatcttgctttttct
gaaattttatttactgctatcttttcttttttgttttttttaatttttgaaccaagaaat
ctccccttaaattttattctcaaaaattctttgtctgttatttatttaggaattggtgct
acagcttttactctgaccttacaacttgttggacaaaaatatgtttctcctactaaatct
gccttaatctataatttggaaccagtgtttgctactttatttgcctttttacttctctcc
gaaaaattaaattttcagcaaatcataggagcatccttaatattgatatctttatttatc
tctattccctcatcctttcaaaataagtcctaa

DBGET integrated database retrieval system