KEGG   Dictyoglomus thermophilum: DICTH_0695Help
Entry
DICTH_0695        CDS       T00774                                 

Definition
(GenBank) DegV family protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegV Dak1_2 DUF3553
Motif
Other DBs
NCBI-ProteinID: ACI18364
UniProt: B5YDF8
Position
complement(700238..701143)
Genome map
AA seq 301 aa AA seqDB search
MEKDLKFKVVTDSTADIPEEISKALGIEVIPYYIHLEGRSFKESIEITPEEVWSYLEKTE
DLSKLPKTACPGVGEYYETFKKILEEGKRVLSIHMTSWGSGAFQSANTAKQIIKEEEPEA
EIEVLDSKSVSLGTGFMVIEAAKASLKGWDLKKTIEHINEVRSNLFHAFTNDTLKFLAAG
GRIGKAKYLLAEMLKINPIISVDHDGVLVALDKAIGRVKAYQKIVSHMNNFFKDKKFLNI
GFLHASAEEEVKKLKEEISKVFEIKNIIVNKLSAALSVHAGPGTVGVIAYPSNLSIDIET
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggacttaaaatttaaagtagtaaccgacagtactgccgatataccagaagaa
atcagcaaggctttaggtatagaagttattccctactatatacacttagagggaagatcc
tttaaagaaagtatagaaataactccagaggaagtttggagctatctagaaaagacagaa
gatttaagcaaattacctaaaacagcctgtcctggagttggagaatactatgaaactttc
aaaaaaatattagaggaagggaaaagagttttaagcatccatatgacctcatggggaagt
ggagctttccaatctgcaaatacagcaaaacaaatcattaaggaggaagagcccgaggct
gaaatagaagttttagattccaagagtgtatccttagggactggttttatggtgatagaa
gctgcaaaagcttctcttaaaggatgggatctaaaaaaaacaatagaacatatcaatgag
gtaaggagtaatttattccatgcctttacaaatgatactctaaaatttcttgcagcagga
ggaagaataggaaaggctaaatatctactcgcagagatgctaaaaataaatcctataata
tctgtagatcatgatggggttttagttgctcttgacaaagctataggaagagtaaaagcc
taccagaagatagtctcccatatgaataacttttttaaagataagaaatttctaaatatc
ggattcttacacgcaagtgctgaagaagaagtgaaaaagcttaaagaagagatctcaaaa
gtatttgaaataaaaaacataatagtaaataaactaagtgcagccctaagcgtacatgca
ggaccaggaactgtaggagtaatagcttatccttcaaatttgtctatcgatattgaaaca
aaatag

DBGET integrated database retrieval system