KEGG   Dictyoglomus thermophilum: DICTH_0697Help
Entry
DICTH_0697        CDS       T00774                                 

Definition
(GenBank) FldZ protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like
Motif
Other DBs
NCBI-ProteinID: ACI19437
UniProt: B5YDG0
Position
complement(703635..704333)
Genome map
AA seq 232 aa AA seqDB search
MNFSEKENLELIELFKGLRVADVRDGLDYLLLHNNFSIPYTIKPLFRIRVVGIAKTVRYI
PYRGEIPKLTPEEYSEWMGYYYTHICPYPWLEEVKKGDFIVIDQSSVDAGLMGSNNSLYG
FSKGVVGYLTNGGPRDTDELILQKIPFWSKFVSQKTVIGRLQYDAMDIPINIEGVTVNPG
DVIIADGDGVLVVPRDKAPVVAELARKELNLDKDSRRKLYDKMGWNYDNTVL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaattttagtgagaaagaaaatctcgaactaatcgaattatttaaaggattacgagta
gcggatgtaagagatggactagattatcttctcttacacaataattttagcatcccttac
accataaaacctttatttagaatcagagtagttggcatagcaaaaacagtaagatatata
ccctatagaggagaaatacctaaattaactccagaagaatattctgaatggatgggctat
tattatacccatatctgtccctatccttggcttgaagaggtaaaaaaaggagattttatt
gtgatagatcaaagcagtgtagacgcaggtctcatgggatcaaataactctttatatgga
ttttcaaaaggagtagttggataccttacaaatggaggaccaagagataccgatgagctt
attctacaaaagattcccttttggagcaaatttgtctctcaaaaaactgttattggaaga
ttacaatatgatgccatggacattcctataaatatagagggagtaacagtcaaccctggg
gatgtaattatcgcagatggcgatggagttttagtagttcctagggataaagcccctgta
gtagcagaacttgcaagaaaggaacttaatttagataaagattcaagaaggaagttatac
gataaaatgggatggaattacgacaataccgttttataa

DBGET integrated database retrieval system