KEGG   Dictyoglomus thermophilum: DICTH_0699Help
Entry
DICTH_0699        CDS       T00774                                 

Definition
(GenBank) transcriptional regulator, GntR family protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 GntR Peripla_BP_4 HTH_11 Peripla_BP_1 HTH_24 HTH_Crp_2 TrmB AbiEi_4 HTH_DeoR Rrf2 HTH_36 HTH_28 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ACI19658
UniProt: B5YDG2
Position
704900..705931
Genome map
AA seq 343 aa AA seqDB search
MGISPLVKEKIKEELLKIIESSRKDDYVKISSERELAQIFAVSRTTIRSVIKELIEEGML
VQIQGKGTYITPKTEKFVYVLNSPDLKSDDPFYSKFFVELTNKLTKKGFNLNFISMDRIA
RKKDKEVPVLIIGVINDGTIEKLKNNFRYLISIEQYFNHDEIIQISVDDYRIGWSAAEAL
IKRNHDYIIHLCGPERYTAPRLRKLGFWDRVKIEPKVKYEIIEGKMNYKSGYELGEKVLE
IFNKEKRSKIGIFAANDWMAIGLMQRLKEAGVIAGRDLSVIGCDDVPLSTEVVPNLTTFK
WDIEKIVEEILGVLSDIINKRKSVFDKRVLVPAEFVIRQTLMD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtatatcgcctttagttaaagagaaaattaaagaggagttgctgaaaataattgaa
agtagtagaaaagatgactatgtaaaaatctcttctgagagagaactggctcaaatcttt
gctgtgagtaggaccactataagaagtgtgataaaggaactaatagaagaaggaatgtta
gtacaaattcaagggaaaggaacttatataacccctaaaacagaaaaatttgtttatgtt
ttgaattctccagatttaaaaagcgatgatcctttttactctaaattttttgtggaatta
acgaataaacttacaaaaaaaggttttaatttgaattttatatccatggatagaattgct
cgaaaaaaagacaaggaagtgccagtactcattataggggtaattaatgacggaactatt
gaaaaacttaaaaataatttcagatatttaatttctattgagcagtattttaatcatgat
gaaatcattcagatttctgtagatgattatagaataggttggtctgcggcagaggccctc
attaagagaaatcacgattatattattcatctttgtggaccagagagatatacggcacct
cgtttaagaaagttgggcttttgggatagagttaaaattgagcctaaggtaaaatatgaa
ataattgagggaaagatgaattataaatcgggttatgaattaggtgaaaaggtcttagag
atttttaataaagagaaaagaagtaaaattggaatttttgctgcaaatgactggatggct
ataggcttgatgcagaggttgaaagaggctggtgttatagcaggtagggacttaagcgtt
attggatgtgatgatgttcctttatcgacggaggttgttcctaatttgactacttttaaa
tgggatattgagaaaattgtggaagaaattttgggggttttgagtgatataataaacaaa
agaaagtctgtttttgataaaagagttcttgtgcctgctgaatttgtaataagacagact
ctaatggattga

DBGET integrated database retrieval system