KEGG   Dictyoglomus thermophilum: DICTH_0709Help
Entry
DICTH_0709        CDS       T00774                                 

Definition
(GenBank) outer membrane protein, putative
  KO
K19765  heat shock factor-binding protein 1
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IncA Baculo_PEP_C NPV_P10 Reo_sigmaC SLH DUF1664 Spc7 BLOC1_2 TolA_bind_tri Laminin_II SlyX DUF2730 FlaC_arch DUF4407 Rab5-bind MscS_porin Prefoldin_2 DUF16 Phage_GP20 Snapin_Pallidin CENP-F_leu_zip DUF4795 TBPIP DUF3450 AAA_13 Spectrin HsbA Lebercilin XhlA ATG16 EzrA DUF4763 Seryl_tRNA_N Tropomyosin_1 APG17 Prominin DUF724 Bacillus_HBL Fib_alpha TelA Cluap1 Sec34 Syntaxin_2 Laminin_I APG6 DUF948 MCPsignal Syntaxin-6_N Filament Mod_r TMF_TATA_bd MAD Golgin_A5 DASH_Dad1 DUF812 ISG65-75 LPP Atg14 Vac_Fusion HOOK CENP-H GIT_CC Cep57_MT_bd COG5 LXG KASH_CCD YscO-like Not3 Erythro-docking DUF4349 Baculo_F
Motif
Other DBs
NCBI-ProteinID: ACI18646
UniProt: B5YDH2
Position
717446..719293
Genome map
AA seq 615 aa AA seqDB search
MSRRILSLVLMVFLVLSVSYAQVGKFKDVPSNHWAAEAVKYLTDLGIISGIKPDTFAGDL
YVTRYQVAVLLYKLIQALQTGKIALPATDVSELKDLVSQLQDELQLIGANVEDLMNALQD
LDSRVSDLETAITEKVGVEDVENIVNEALADVNARLDDLEAKIEAIEKVEITPEQIEAVV
GDKLEQLVESKMEELTSRVTDLEGFVTDLDSRLADVEAALVDKPSLDEVEAMIEEKLGSI
EVPDVEELTGRVTDLEDRVSAVETRLDDVDSAISDIMSSVDDLNANLVDLSGKVDEVLAL
KDQLDELIARIESIQGIEIPVELDEIKSFIMDLDSRLTELSTSVDDLSTVVADLQSQIDD
INSKFDQVNTNIDNINSSIEALSTSVDDLFVLNDGVSTRLDETVNRLVTLEERVATLENK
ATVEKNFALDLRFTVKVGLATRTPVNTLTTKLTFNLMPSVKLFLQSVSSASGIDMSGGVD
ASMPISKDITGVAGASYDNGKFSVYGGVKLAMLKNAVIDVIVGVPDVMALGSGELKDTVS
LKIGGSYKLTDKVSLTGYATNLEGGAAAANFAVVYAVDPKADLSLGLYLYGLGNLLGGNF
DAVQKSVVFSAGASF
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggaggattttaagtttagtattaatggtattcttagtcttaagtgtttcttat
gcacaggtaggtaaatttaaggatgttccatctaatcattgggcagcagaagcagttaag
tacttaacagatttagggataatttctggaatcaaacctgatacttttgctggagatcta
tatgtaacaagatatcaagttgctgtcttactctataagttaatacaagctctacaaact
ggtaaaatagccttgcctgcaaccgatgttagtgaacttaaagaccttgtttctcaactc
caggatgaattgcagcttattggagcaaacgtagaagatttaatgaatgcgttacaagat
cttgattcaagagtttctgacttagaaacagcgattactgagaaagtgggagtagaagat
gtagagaatatagtcaatgaggcacttgcggatgtaaatgcaaggcttgatgatttagag
gcaaagatagaagctatagaaaaagtggaaattactcctgaacaaattgaggcagtagtt
ggagataagttagagcaacttgtagaatcaaaaatggaggagttaactagcagagttact
gatcttgagggatttgttactgacttagattcaagacttgcagatgttgaggcagcatta
gtagataagccatctttagatgaagtagaggcaatgattgaggagaaattaggttcaatt
gaggttccagatgtggaggagttaactggcagagttactgatcttgaggatagggtttcg
gcagttgaaacaagacttgatgatgtagacagtgcaatttctgatattatgagttcagta
gatgatctaaatgcaaatcttgtagatctttctggaaaggtcgatgaggtacttgcatta
aaagatcaacttgatgagttaatagcaaggatagaatctatacagggtatagagattcct
gtagaacttgatgagattaaatcattcataatggatttagactcaaggttaacagagctt
tctaccagtgtagatgatctaagtacagtagtagctgatttacaatctcagattgatgat
attaattcgaaatttgatcaagttaatacaaatattgataatatcaactcttctatagaa
gctctatctaccagtgtggacgatctatttgtgcttaatgatggagtatctacaagatta
gatgaaacagtaaatagattagttactttagaagagagggtggctactcttgagaataaa
gctactgtagagaagaattttgcattggatttaagatttacagtaaaagttggtttggcc
acaagaaccccagtgaatactcttacaacaaagttaacatttaatttgatgcctagtgta
aaactcttcttacaatctgtgagtagtgctagtggaattgatatgtctggtggtgtagat
gcaagcatgccaattagcaaagatataacaggtgttgcaggagcttcatatgataatggt
aagttctcagtttatggtggtgtgaagcttgcgatgttaaagaatgctgtaattgatgtt
atagtaggagttccagatgttatggctcttggcagtggagaactaaaagatacagtatct
ttgaagattggtggatcttataaattaactgataaagttagcttaacaggatatgcaaca
aatcttgaaggtggtgcagcagcagctaattttgcagtagtgtatgctgtagatcctaag
gctgatctatctttaggattgtacttgtacggtctaggaaatctacttggaggtaatttt
gacgctgtccaaaaatccgtagtattctctgcaggagcttccttctaa

DBGET integrated database retrieval system