KEGG   Dictyoglomus thermophilum: DICTH_0723Help
Entry
DICTH_0723        CDS       T00774                                 

Definition
(GenBank) FimO
  KO
K02653  type IV pilus assembly protein PilC
Organism
dth  Dictyoglomus thermophilum
Brite
KEGG Orthology (KO) [BR:dth00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dth02044]
    DICTH_0723
   02035 Bacterial motility proteins [BR:dth02035]
    DICTH_0723
Secretion system [BR:dth02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   DICTH_0723
Bacterial motility proteins [BR:dth02035]
 Pilus system
  Pilus assembly proteins
   DICTH_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF DUF2207 BAR_3 DUF4320
Motif
Other DBs
NCBI-ProteinID: ACI20015
UniProt: B5YDI4
Position
732524..733753
Genome map
AA seq 409 aa AA seqDB search
MAKVYVYQARNMKGELVTGEYEAENMREVAIRLRGMNLYPIRIEEKRTPSSFFSLTLAPK
KERVGKVKLTDLTVFTRQFATMINAGLSLSTCLNILSEQSESKALKQILKEVQRMVDEGS
SLSEAFAKFPDVFSPLYINMVKAAESAGTLDETLERLAVTLEKQQELRRKIKSAMTYPVI
VLIIAIGAGFGMLTFLVPIFAGMFESMGAQLPLPTAILLKMSKFITSNILLILLGAIILV
LGAIRAWKNPKIKDKIDEIILKIPVFGGLIQKTSVVNFATTLAAQVRTGVPILQALQLAG
QTAGNSVFRKAIDLTRQRVREGERIAPVLRETKVFPPMVVHMISIGEESGSLEQMLNKIA
EFYEGEVAAAVESLTSLIEPLMMVFVGGIVGGMLIALYLPIFTMFQYIK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagtatatgtttatcaagcacgaaatatgaaaggtgagttagtcactggagaa
tatgaagcagaaaacatgagagaggtagccataaggttaagaggaatgaatttgtaccct
ataagaatagaggagaaaagaacgccctcctcatttttcagtttaacattagcgcctaaa
aaggaaagagttggaaaggtaaagttaacggatcttacagtgtttacaagacagtttgct
acaatgattaatgcaggcctttctctttctacttgtctaaatattctctctgaacagagt
gaaagtaaagcattaaagcagatactaaaggaagttcagagaatggtagatgaaggaagt
tctctttctgaggcttttgcaaaatttcctgatgttttttctcctttatatataaatatg
gtgaaagcagcagaatctgctggaaccctcgatgaaactttggaaagacttgcagtgact
cttgaaaagcaacaggaattaagaagaaaaataaaatctgccatgacttacccagttata
gtgttgatcattgctattggagctggttttggcatgttgacctttcttgttcctatattt
gcaggtatgtttgaaagtatgggagctcaacttcctttacctactgccatactcttaaag
atgagtaaatttataactagcaatattcttttgattttgcttggggcaataattttagtg
ctgggagccataagagcttggaagaatcctaagataaaggataaaatagacgaaataatt
ttgaagattccagtttttggaggcttaattcaaaagacctcagtggtaaattttgcgacc
actcttgcagctcaggtaagaactggagttcctatccttcaagcattacagctcgccgga
caaacagcaggaaatagtgtgtttagaaaagcaattgatttaacaaggcaaagggttaga
gagggagaaagaattgcgcctgttttaagggaaacaaaggtattcccaccaatggtggta
catatgatatctattggagaagaatctggttctttggaacaaatgttaaataagatcgca
gaattttatgaaggtgaagtagcagcagcggttgagagtttgacttctcttattgagcct
ttaatgatggtatttgtgggtggtatagttggtggaatgctaattgcattatacctacct
atattcaccatgttccagtacataaaatga

DBGET integrated database retrieval system